DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArgRS and CG8097

DIOPT Version :9

Sequence 1:NP_573081.1 Gene:ArgRS / 32539 FlyBaseID:FBgn0027093 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_001285279.1 Gene:CG8097 / 32495 FlyBaseID:FBgn0030660 Length:446 Species:Drosophila melanogaster


Alignment Length:485 Identity:99/485 - (20%)
Similarity:165/485 - (34%) Gaps:149/485 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 QFGMLIAHLED-----------RFPNYLNESPPISDLQLFYKES--KKRFDEDEEFKKRAYSRVV 299
            :||.||.:..|           ..|.|         .|.:.|..  |.|.|.||.          
  Fly    38 KFGKLIRYNNDDLTEQGDLTLAAIPRY---------WQKYLKSQGLKLRIDGDEL---------- 83

  Fly   300 SLQKGVPNSIKAWELICNVSRKEFQTIYERLDISVKERGESFYQ-----SRMLSVVEYLRGKGLL 359
                 :|:.:...||: ..||| ::.....:.:..|||....:|     :.:|:.|..|||    
  Fly    84 -----LPSPVDRLELM-EHSRK-WRFPLAEITVLNKERYSLRFQRHPIIAHVLNSVLTLRG---- 137

  Fly   360 EVDEGREIMWPDDTKTGIPLTIVKS--DGGFTYDTSDMAAIRHRLEEELCDWIIYVVD------- 415
              |.||...........:.|..|..  |||        ..:||...::|...::.:||       
  Fly   138 --DYGRSANNNQSRTICLQLQAVVGAVDGG--------QDLRHYRLQQLYKILLRLVDYSSWRLV 192

  Fly   416 SGQSTHFNTIFKAAERSAILNPLSHRVDHV--QFGVVLGEDGKKFKTRSGDTVKLSDLLDEGMKR 478
            .......:||....|.....|. ...|:||  ..|.||....|...:.:         :||.:|.
  Fly   193 EPNDRQKDTICVTVELEKCCNG-KQPVEHVCLTCGPVLEPINKGASSLT---------VDEYLKL 247

  Fly   479 SLQQLESRGRDKVLTPQELKDAQESLAYGCIKYSDLCHNRISDYIFSFDKMLEDRGNTAV----- 538
            ..|.:|.....:                     |.:|...:|    |.|.:.:.....||     
  Fly   248 RCQHMELMATQR---------------------SGMCPVPMS----SLDTLTKRLAAAAVIVDLF 287

  Fly   539 ----------------------YLLYTYTRICSIARNSGEDFTN-----LPEILKKTNI-VLDHE 575
                                  |:||...|:.::.|....:..|     || :|.:.:: ||:.:
  Fly   288 VVRHSSAVSVVRNGVGICKGASYILYNSARLEALLRKFNYEVNNCAYEKLP-LLDEIDLSVLEDD 351

  Fly   576 KEWKLA-KTLLKLHDILIKCSKEL-----FLHFLCEFCFEVCTVFTEFYDSCY--CIEKNKQGDI 632
            .:|:|. ..||...:::.....:|     .||.|..:...:...|:.||   |  .:...|:.::
  Fly   352 VDWELIYGYLLTFPELMESIMDQLDQGHCGLHLLVHYVENLAAAFSRFY---YHKKVLLQKRDEL 413

  Fly   633 IGVNHSRILLCEATAAVLRQCFYILGLKPV 662
            :.:.::||.|.:|...||.....:||::||
  Fly   414 MPILYARIYLIKAVRQVLNTALAVLGIEPV 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArgRSNP_573081.1 Arg_tRNA_synt_N 81..171 CDD:214975
PLN02286 83..665 CDD:215160 99/485 (20%)
ArgRS_core 197..463 CDD:185675 53/243 (22%)
DALR_1 540..665 CDD:214846 33/137 (24%)
CG8097NP_001285279.1 DALR_1 311..445 CDD:214846 33/137 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0018
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.