DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8565 and Mapk10

DIOPT Version :10

Sequence 1:NP_573080.1 Gene:CG8565 / 32538 FlyBaseID:FBgn0030697 Length:790 Species:Drosophila melanogaster
Sequence 2:NP_001394501.1 Gene:Mapk10 / 26414 MGIID:1346863 Length:494 Species:Mus musculus


Alignment Length:91 Identity:24/91 - (26%)
Similarity:38/91 - (41%) Gaps:18/91 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SPRNDSTRKHRK---SRSIKDDQHYP-PVSFVGVESVGIIECPGSNHLS-----------LASIP 51
            ||.|  ...||:   :.|.:..||.| |...:...|.|:...|.:|.|.           .||..
Mouse  1733 SPEN--LHAHRRPVSANSAEPKQHPPGPRPLIHSHSTGLRFSPSTNSLGPASAANLGPGFRASTS 1795

  Fly    52 TTEFKIPDELALWVRGRIDNVAPKHP 77
            ..:.:||.:|: :..|..|:::|..|
Mouse  1796 AQQMEIPLKLS-YESGYHDDLSPVSP 1820

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8565NP_573080.1 Protein Kinases, catalytic domain 192..722 CDD:473864
Mapk10NP_001394501.1 STKc_JNK 93..428 CDD:270840
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.