DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8565 and LOC110438375

DIOPT Version :9

Sequence 1:NP_573080.1 Gene:CG8565 / 32538 FlyBaseID:FBgn0030697 Length:790 Species:Drosophila melanogaster
Sequence 2:XP_021326237.1 Gene:LOC110438375 / 110438375 -ID:- Length:203 Species:Danio rerio


Alignment Length:159 Identity:67/159 - (42%)
Similarity:95/159 - (59%) Gaps:4/159 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 RYCAVKVSKSAQVYKETGIDEIMLFSQMSLHD-QHKYRSHVVGFYDFFEITGPHGRHICLVLEVL 290
            |:.|:||.||||.|.||.:|||.|...:...| :...:..||...|.|:|:|.:|.|:|:|.|||
Zfish    31 RFVAMKVVKSAQHYTETALDEIKLLRCVRETDPEDPNKDMVVQLIDDFKISGVNGIHVCMVFEVL 95

  Fly   291 GDNLLKVIERCFYKGMPISNIKQIAQQVLTGLKFLHEECGIIHTDLKPENVLLASNEVSVRTEIK 355
            |.:|||.|.:..|:|:|:..:|.|.:|||.||.:||.:|.|||||:||||:|:..::..||   :
Zfish    96 GHHLLKWIIKSNYQGLPLPCVKSIIRQVLQGLDYLHSKCKIIHTDIKPENILMCVDDAFVR---R 157

  Fly   356 TAIEVYLKANEGKLSPSSKMTKTAKRRMQ 384
            .|:|.......|...||.....||.:..|
Zfish   158 MAVEATEWQKAGAPPPSGSAVSTAPQLKQ 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8565NP_573080.1 PKc_like 192..722 CDD:304357 67/159 (42%)
LOC110438375XP_021326237.1 PKc_like 28..>184 CDD:328722 66/155 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D290680at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.