DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chc and Clhc1

DIOPT Version :9

Sequence 1:NP_001096993.1 Gene:Chc / 32537 FlyBaseID:FBgn0000319 Length:1678 Species:Drosophila melanogaster
Sequence 2:NP_082780.1 Gene:Clhc1 / 73324 MGIID:1920574 Length:596 Species:Mus musculus


Alignment Length:486 Identity:108/486 - (22%)
Similarity:189/486 - (38%) Gaps:124/486 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 LVTETSVFHWSMEGD-----SMPQKMFDRHSSLNG---CQIINYRCNASQQWLLLVGISALPSRV 177
            :.|||.......||.     ::.:.:||:.|:.:.   .|:|:|             :||..|  
Mouse    31 ITTETKRVGCKEEGPADEYYTIYRNVFDKFSATDRKIIFQVIDY-------------VSAYKS-- 80

  Fly   178 AGAMQLYSVERKVSQAIE----GHAASF---ATFKIDANKEPTTLFCFAVRT-ATGGKLHIIE-- 232
                .|.:::::....||    |...:|   ...|:.| ||||.|.....|. ....|:.|||  
Mouse    81 ----ILTAIKKEYDAFIETIKKGRRTAFYLHGKLKVLA-KEPTALVYHQRRAIQLEAKMRIIENN 140

  Fly   233 -------VGAPPNGNQPFAKKAVDVFFPP-EAQNDFP-VAMQVSAKYDTI-----YLITKYGYIH 283
                   :.........:.||.|.:..|. :.....| :.:|.|...:.:     ||..|  ||.
Mouse   141 STAIQLQIDQMKQLRMEYDKKEVKLCAPSRQLWKPIPGMTLQDSVNLEALNKHKQYLEDK--YIK 203

  Fly   284 L-YDMETATCIYMNRISADTIFVTAPHEA---SGGIIGVNRKGQVLSVTVDEE------QIIPYI 338
            | .||             .|::|.|..:|   ...::.:||:....::..|.:      |:|.:.
Mouse   204 LKQDM-------------STMYVPAQKKAELDEEMVVLLNRRDIAENLKKDRQFRHQRLQVISHT 255

  Fly   339 NT--VLQN-----PDLALRMAVRNNLAGAEDL--------------------FVRKFNKLFTAGQ 376
            .|  :.||     .|:..|:.....:.|.:::                    ::.:||.|.:.|:
Mouse   256 LTPWMKQNMRISFQDVMERIRKTKAIYGYDNIVDEIFEDDPNKKKEAIVMLHYIERFNDLISLGE 320

  Fly   377 YAEAAKVAALAPKAILRTPQTIQRFQQVQTPAGSTTPPLLQYFGILLDQGK-----LNKFESLEL 436
            |..||..||.:||.||:...|:.:|:.:....|... |||.:|..:.:..:     :|...::|.
Mouse   321 YERAACFAANSPKRILQNTSTMNKFKAIGKIRGKPL-PLLLFFEAIFNTSQAFKRPINADLTMEG 384

  Fly   437 CRPVLLQGKKQLCEKWLKEEKLECSEELGDLV----------KASDLTLALSIYLRANVPNKVIQ 491
            .:..|.:.:..|...|:.:|||..||:.||::          |...|.||..||....:..|.:.
Mouse   385 IKCGLSEERLDLVTHWVTQEKLTFSEKAGDIIFAYGEQHTYHKPRCLALAQIIYNECGLHRKALL 449

  Fly   492 CFAETGQFQKI---VLYAKKVNYTPDYVFLL 519
            |..:.||..:.   :..:|.:| |.|.:.|:
Mouse   450 CLCKQGQIHEAMEHIQQSKDIN-TDDLIQLI 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ChcNP_001096993.1 Clathrin_propel 19..56 CDD:279702
Clathrin_propel 148..187 CDD:279702 7/41 (17%)
Clathrin_propel 198..234 CDD:279702 13/48 (27%)
Clathrin_propel 256..288 CDD:279702 10/38 (26%)
Clathrin_propel 296..330 CDD:279702 6/36 (17%)
Clathrin-link 331..353 CDD:286367 7/34 (21%)
Clathrin_H_link 364..422 CDD:290550 20/57 (35%)
CLH 542..672 CDD:128594
Clathrin 546..679 CDD:279031
CLH 687..825 CDD:128594
Clathrin 697..827 CDD:279031
CLH 834..969 CDD:128594
Clathrin 844..971 CDD:279031
CLH 980..1118 CDD:128594
Clathrin 984..1120 CDD:279031
CLH 1129..1266 CDD:128594
Clathrin 1134..1268 CDD:279031
CLH 1275..1417 CDD:128594
Clathrin 1279..1417 CDD:279031
CLH 1428..1579 CDD:128594
Clathrin 1429..1562 CDD:279031
Clhc1NP_082780.1 TSNAXIP1_N 30..145 CDD:374065 31/133 (23%)
Clathrin_H_link 308..365 CDD:372748 20/57 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849975
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0985
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.