DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sd and LOC689519

DIOPT Version :9

Sequence 1:NP_001368984.1 Gene:sd / 32536 FlyBaseID:FBgn0003345 Length:747 Species:Drosophila melanogaster
Sequence 2:XP_006237485.1 Gene:LOC689519 / 689519 RGDID:1591108 Length:170 Species:Rattus norvegicus


Alignment Length:191 Identity:83/191 - (43%)
Similarity:101/191 - (52%) Gaps:46/191 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 HLFVQLGGKPSFSDPLLETVDIRQIFDKFPEKSGGLKDLYEKGPQNAFYLVKCWADLNTDLTTGS 309
            ||.....|  ||..|||| |....:.||     |...|...:.       :..||          
  Rat    26 HLIAATSG--SFPFPLLE-VSACLVTDK-----GERPDFISRN-------LLGWA---------- 65

  Fly   310 ETGDFYGVTSQYESNENVVLVCSTIVCSFGKQVVEKVESEYSRLENNRYVYRIQRSPMCEYMINF 374
                       :...|.::.:|          |....::|::|.||..|:|||.|||:|||||||
  Rat    66 -----------WAGGEGILSLC----------VPGIPQTEFARYENGHYLYRIHRSPLCEYMINF 109

  Fly   375 IQKLKNLPERYMMNSVLENFTILQVMRARETQETLLCIAYVFEVAAQNSGTTHHIYRLIKE 435
            |.|||:|||:|||||||||||||||:..|:||||||||||||||:|...|..||||.|.||
  Rat   110 IHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYCLRKE 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sdNP_001368984.1 TEA 88..155 CDD:128703
YBD 224..432 CDD:407601 80/186 (43%)
LOC689519XP_006237485.1 TEA <82..162 CDD:261366 57/79 (72%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D355519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.