DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sd and LOC101887189

DIOPT Version :9

Sequence 1:NP_001368984.1 Gene:sd / 32536 FlyBaseID:FBgn0003345 Length:747 Species:Drosophila melanogaster
Sequence 2:XP_021326442.1 Gene:LOC101887189 / 101887189 -ID:- Length:269 Species:Danio rerio


Alignment Length:160 Identity:85/160 - (53%)
Similarity:93/160 - (58%) Gaps:41/160 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KNITSSST----------C--STGLLQLQNNLSCSELEVAEKTEQQAVGP-GTIPSPWTPVNAGP 53
            |::|...|          |  |.||.|:          |........|.| .|:.|.|  .:|..
Zfish   138 KHLTQDCTSAHFQTWKILCFPSHGLFQI----------VLSVRRGVCVSPSSTLSSEW--ASASS 190

  Fly    54 PGALGSADTNGSMVDSKNLDVGDMSDDEKDLSSADAEGVWSPDIEQSFQEALSIYPPCGRRKIIL 118
            ||| .|.|.      |:.||        |.|.: ||||||||||||||||||:||||||||||||
Zfish   191 PGA-ASEDL------SEGLD--------KPLEN-DAEGVWSPDIEQSFQEALAIYPPCGRRKIIL 239

  Fly   119 SDEGKMYGRNELIARYIKLRTGKTRTRKQV 148
            ||||||||||||||||||||||||||||||
Zfish   240 SDEGKMYGRNELIARYIKLRTGKTRTRKQV 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sdNP_001368984.1 TEA 88..155 CDD:128703 60/61 (98%)
YBD 224..432 CDD:407601
LOC101887189XP_021326442.1 TEA 209..269 CDD:128703 58/59 (98%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D823827at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.