DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8509 and CG2104

DIOPT Version :9

Sequence 1:NP_573079.1 Gene:CG8509 / 32535 FlyBaseID:FBgn0030696 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_001262299.1 Gene:CG2104 / 40702 FlyBaseID:FBgn0037365 Length:424 Species:Drosophila melanogaster


Alignment Length:368 Identity:120/368 - (32%)
Similarity:207/368 - (56%) Gaps:39/368 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 RASAFMQN---GPVKQVRSLEDLDRWVRSQAYYDIIAYISNTSKAIQGHRLTQTFPVTEQMRRLS 79
            |.:||.:.   |||.:|:|..|::.|:.|:||:.:|.|:::.|..|||.|.|..||:::.::||:
  Fly    11 RVAAFFRRSNIGPVCRVQSSSDMEAWLASRAYFTLITYLNDVSAEIQGIRNTDLFPISKNIKRLT 75

  Fly    80 EIFDGLDHLIVEHTPKIEDSYLALPFG---QVRSKAYRTWMREMYQHVFSKLDEAI-NVNCKHIN 140
            .||:.||.:||.::|      ..|..|   ..|:|:||.|...|.:.::..:::|: :..|:|:|
  Fly    76 TIFEQLDSMIVANSP------APLVLGANMDSRTKSYRRWAHGMLRDIYKIVEKAVPSSKCRHVN 134

  Fly   141 ELGQYLRRSFGNGNTLDFGPANELMFLFFLCGLFRAGIL-LAKDTVAAALMLFNRYVNVVRRLIS 204
            |||.||..|||:...:::|..:||.||||:|.||:|.|| ..:|..|:||:||:||::.||||..
  Fly   135 ELGVYLSGSFGSSAKIEYGTGHELSFLFFVCALFKAEILDKEQDLAASALVLFDRYLHFVRRLQV 199

  Fly   205 TYGLTIAK-DPACTIEDYYFLPYLWGAAQLSVDSPFSPMQCEQGKIMDNYRQDFMMLEIIDHLQK 268
            ||.:..:. ....:::.:.|:|::||.|||..::||||.:......:..||..:|::..:.|:..
  Fly   200 TYSVNSSNWHGGYSLDKFQFVPFVWGFAQLCHEAPFSPKKMLDEDTIAKYRDAYMLINCVGHMAT 264

  Fly   269 TRSGPLSRVALQLWSILSIPTWPQVYRGLERNYIDHVLSSFGTVEQAIFCELMSFEAVVPIMPLQ 333
            |..|..:|.:.||||:.::.:|.:::|.|...|::.:|.....:....|.||||||         
  Fly   265 TNVGTFARHSSQLWSLAALSSWTKIHRSLMFMYMEDILMDIDNLNALRFGELMSFE--------- 320

  Fly   334 RAHLGTHLIVDEKENEDELEQKYGENRWSLSPPVSRYVSMEPE 376
                           ||:..:..|..|..:..|:.|.::.:|:
  Fly   321 ---------------EDKSGRHLGSARMGVKSPLRRQMAEDPD 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8509NP_573079.1 PTPA 27..324 CDD:281137 107/302 (35%)
CG2104NP_001262299.1 PTPA 44..314 CDD:239754 93/275 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468028
Domainoid 1 1.000 198 1.000 Domainoid score I581
eggNOG 1 0.900 - - E1_COG5057
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1048
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1165705at2759
OrthoFinder 1 1.000 - - FOG0002736
OrthoInspector 1 1.000 - - otm46691
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.