DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8509 and Ptpa

DIOPT Version :9

Sequence 1:NP_573079.1 Gene:CG8509 / 32535 FlyBaseID:FBgn0030696 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_523466.2 Gene:Ptpa / 33555 FlyBaseID:FBgn0016698 Length:398 Species:Drosophila melanogaster


Alignment Length:316 Identity:125/316 - (39%)
Similarity:188/316 - (59%) Gaps:17/316 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KQVRSLEDLDRWVRSQAYYDIIAYISNTSKAIQGHRLTQTFPVTEQMRRLSEIFDGLDHLIVEHT 93
            |:|::|.|:..|.:|:|::|:|.||:.||.||||.:.|.....:|.:::|..:||.|:.| ||..
  Fly    17 KKVQNLGDMGVWQKSRAFHDLIGYINGTSSAIQGIKTTDEIFESEMLKKLLRLFDALEKL-VEQN 80

  Fly    94 PKIEDSYLALPFGQVRSKAYRTWMREMYQHVFSKLDEAINVNCKHIN-ELGQYLRRSFGNGNTLD 157
            |.:|...   .||   :||||.|.:.|.:.:...|::.:..:.|... ||||||..||||...:|
  Fly    81 PPLEQPQ---RFG---NKAYRDWAQAMRELLPELLEQLLPDDKKRYQVELGQYLTESFGNATRID 139

  Fly   158 FGPANELMFLFFLCGLFRAGILLAKDTVAAALMLFNRYVNVVRRLISTYGLTIAKDPA-----CT 217
            :|..:||.||||||.||:|.||..:|.|:|||.|||||:.:.|:|..||.:    :||     .:
  Fly   140 YGTGHELSFLFFLCSLFKAEILQERDIVSAALRLFNRYLELARQLQRTYNM----EPAGSQGVWS 200

  Fly   218 IEDYYFLPYLWGAAQLSVDSPFSPMQCEQGKIMDNYRQDFMMLEIIDHLQKTRSGPLSRVALQLW 282
            ::|:.|:|::||:|||:|.|||.|.:.....|:..|:..||.:..||::.|.::|.....:.|||
  Fly   201 LDDFQFVPFIWGSAQLAVKSPFDPSKFVDEAIITEYKDHFMFISCIDYICKVKTGHFGEHSNQLW 265

  Fly   283 SILSIPTWPQVYRGLERNYIDHVLSSFGTVEQAIFCELMSFEAVVPIMPLQRAHLG 338
            ||..:|||.::..||.:.|...:||.|..::...|.|||:||.|.....|..|.||
  Fly   266 SITDVPTWAKINAGLVKMYQKEILSKFPVIQHVYFGELMTFEPVSSGTTLSNARLG 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8509NP_573079.1 PTPA 27..324 CDD:281137 118/300 (39%)
PtpaNP_523466.2 PTPA 17..308 CDD:281137 119/301 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468029
Domainoid 1 1.000 198 1.000 Domainoid score I581
eggNOG 1 0.900 - - E1_COG5057
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1048
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1165705at2759
OrthoFinder 1 1.000 - - FOG0002736
OrthoInspector 1 1.000 - - otm46691
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.