DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LE and Pglyrp2

DIOPT Version :9

Sequence 1:NP_001245695.1 Gene:PGRP-LE / 32534 FlyBaseID:FBgn0030695 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_006524773.1 Gene:Pglyrp2 / 57757 MGIID:1928099 Length:544 Species:Mus musculus


Alignment Length:210 Identity:74/210 - (35%)
Similarity:111/210 - (52%) Gaps:20/210 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 PTHFEDDYQDESEERVRSDVFIRRQKFK-----IPKELSAIIPRSSWLAQKPMDEPLPLQLPVKY 201
            |.|.:  .|:.|:|::.....:..::|.     .|    ||.||..|.|......|.||:||:.:
Mouse   328 PEHLQ--LQNISQEQLAQVATLATKEFTEAFLGCP----AIHPRCRWGAAPYRGHPTPLRLPLGF 386

  Fly   202 VVILHTATESS-----EKRAINVRLIRDMQCFHIESRGWNDIAYNFLVGCDGNIYEGRGWKTVGA 261
            :.:.||...:.     :..|.:   :|.||.||.:.|.|:||.|:|:||.||.:|:||||..|||
Mouse   387 LYVHHTYVPAPPCTTFQSCAAD---MRSMQRFHQDVRKWDDIGYSFVVGSDGYLYQGRGWHWVGA 448

  Fly   262 HTLGYNRISLGISFIGCFMKELPTADALNMCRNLL-ARGVEDGHISTDYRLICHCQCNSTESPGR 325
            ||.|||....|::|:|.:...||...|||..|:.| :..:..|.:..||:|:.|.|...|..||.
Mouse   449 HTRGYNSRGFGVAFVGNYTGSLPNEAALNTVRDALPSCAIRAGLLRPDYKLLGHRQLVLTHCPGN 513

  Fly   326 RLYEEIQTWPHFYNI 340
            .|:..::|||||..:
Mouse   514 ALFNLLRTWPHFTEV 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LENP_001245695.1 PGRP 175..317 CDD:128941 57/147 (39%)
Pglyrp2XP_006524773.1 PGRP 360..505 CDD:128941 58/151 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842412
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.810

Return to query results.
Submit another query.