DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LE and pglyrp6

DIOPT Version :9

Sequence 1:NP_001245695.1 Gene:PGRP-LE / 32534 FlyBaseID:FBgn0030695 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001038687.2 Gene:pglyrp6 / 571817 ZFINID:ZDB-GENE-071227-2 Length:498 Species:Danio rerio


Alignment Length:285 Identity:97/285 - (34%)
Similarity:139/285 - (48%) Gaps:36/285 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LGTQIATKKHSIISDTIRDLMNSINSIQTLGNVN---ISNSTNVHIGNVTNINGNIQIIADGLTQ 123
            ||:::|:..|.  .:::..|:.|..| |.|.:..   ||....::..|:.:.:.....:...||.
Zfish   236 LGSEMASSDHP--EESLSSLLRSYYS-QKLDDAAPRLISQKRRMNFRNMADFSLMKTQVVRALTV 297

  Fly   124 NRRDRRHVSPPRDNAPKTPTHFEDDYQDESEERVRSDVFIRRQKFKIPKELSAIIPRSSWLAQKP 188
                ||:::  :|...|.     ||..:|..|.     |:.     :......||.||.|.|...
Zfish   298 ----RRNLN--QDERKKL-----DDVVNEGFEE-----FVH-----VYAVCPNIITRSQWGAASY 341

  Fly   189 MDEPLPLQLPVKYVVILHTATESS-----EKRAINVRLIRDMQCFHIESRGWNDIAYNFLVGCDG 248
            :..|..|.|||:|:.|.||...|.     |:.|..   :|.||.:|.:|.||:||.|:|:.|.||
Zfish   342 IGSPSYLSLPVRYLFIHHTYQPSKPCTTFEQCAAE---MRSMQRYHQQSNGWSDIGYSFVAGSDG 403

  Fly   249 NIYEGRGWKTVGAHTLGYNRISLGISFIGCFMKELPTADALNMCR-NLLARGVEDGHISTDYRLI 312
            |:||||||..|||||.|||.|..|:.|||.:...||.:.|:||.| :........|.:|..|.|.
Zfish   404 NLYEGRGWNWVGAHTYGYNSIGYGVCFIGDYTSTLPASSAMNMVRYDFTYCATNGGRLSKSYSLY 468

  Fly   313 CHCQCNSTESPGRRLYEEIQTWPHF 337
            .|.|..:||.||..||.:||||..:
Zfish   469 GHRQAAATECPGNTLYRQIQTWERY 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LENP_001245695.1 PGRP 175..317 CDD:128941 63/147 (43%)
pglyrp6NP_001038687.2 PGRP 328..472 CDD:128941 63/146 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586832
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.