DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LE and PGLYRP4

DIOPT Version :9

Sequence 1:NP_001245695.1 Gene:PGRP-LE / 32534 FlyBaseID:FBgn0030695 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_065126.2 Gene:PGLYRP4 / 57115 HGNCID:30015 Length:373 Species:Homo sapiens


Alignment Length:179 Identity:74/179 - (41%)
Similarity:102/179 - (56%) Gaps:14/179 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 RQKFKIPKELSAIIPRSSWLAQKPMDEPLP-LQLPVKYVVILHTATESSEKRAINVR-----LIR 223
            |||..:.|....::|||.|.|:   :...| :.||.||.:|:|||     .|..|:.     |:|
Human   201 RQKTSLKKACPGVVPRSVWGAR---ETHCPRMTLPAKYGIIIHTA-----GRTCNISDECRLLVR 257

  Fly   224 DMQCFHIESRGWNDIAYNFLVGCDGNIYEGRGWKTVGAHTLGYNRISLGISFIGCFMKELPTADA 288
            |:|.|:|:.....||.||||||.||.||||.||...|:.|.||:.|:|||:|:|.|....|.|.|
Human   258 DIQSFYIDRLKSCDIGYNFLVGQDGAIYEGVGWNVQGSSTPGYDDIALGITFMGTFTGIPPNAAA 322

  Fly   289 LNMCRNLLARGVEDGHISTDYRLICHCQCNSTESPGRRLYEEIQTWPHF 337
            |...::|:...:..|:::.:|.|:.|.....|.|||:.||..|.|||||
Human   323 LEAAQDLIQCAMVKGYLTPNYLLVGHSDVARTLSPGQALYNIISTWPHF 371

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
PGRP-LENP_001245695.1 PGRP 175..317 CDD:128941 58/147 (39%)
PGLYRP4NP_065126.2 PGRP 53..194 CDD:128941
PGRP 211..351 CDD:128941 58/147 (39%)
Interaction with murein 293..302 4/8 (50%)