DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LE and pglyrp5

DIOPT Version :9

Sequence 1:NP_001245695.1 Gene:PGRP-LE / 32534 FlyBaseID:FBgn0030695 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001037786.1 Gene:pglyrp5 / 553387 ZFINID:ZDB-GENE-050419-71 Length:238 Species:Danio rerio


Alignment Length:151 Identity:55/151 - (36%)
Similarity:83/151 - (54%) Gaps:1/151 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 IPRSSWLAQKPMDEPLPLQLPVKYVVILHTATESSEKRAINVRLIRDMQCFHIESRGWNDIAYNF 242
            :.|..|.|.:|. |...::.|...|::.|||.........:|..:..:|..|::.||::||.|||
Zfish    71 VSRRGWDAVQPR-EMTQMESPAHTVIVHHTALRFCAHPRESVTELAHIQRMHMQERGFDDIGYNF 134

  Fly   243 LVGCDGNIYEGRGWKTVGAHTLGYNRISLGISFIGCFMKELPTADALNMCRNLLARGVEDGHIST 307
            |:..||.:||||||..||||...:|..|:||:|:|....:||::.:|:....||..||..||:..
Zfish   135 LISGDGTVYEGRGWGIVGAHAKEHNFYSVGIAFMGNLNADLPSSASLSALLRLLHIGVLHGHVRP 199

  Fly   308 DYRLICHCQCNSTESPGRRLY 328
            ::.|:.|.....|..||..||
Zfish   200 NFVLLGHKDVAKTACPGENLY 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LENP_001245695.1 PGRP 175..317 CDD:128941 50/138 (36%)
pglyrp5NP_001037786.1 PGRP 68..209 CDD:128941 50/138 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586812
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5479
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.710

Return to query results.
Submit another query.