DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LE and pglyrp1

DIOPT Version :9

Sequence 1:NP_001245695.1 Gene:PGRP-LE / 32534 FlyBaseID:FBgn0030695 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_012823786.1 Gene:pglyrp1 / 548492 XenbaseID:XB-GENE-491319 Length:214 Species:Xenopus tropicalis


Alignment Length:166 Identity:63/166 - (37%)
Similarity:89/166 - (53%) Gaps:11/166 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 IIPRSSW-----LAQKPMDEPLPLQLPVKYVVILHTATESSEKRAINVRLIRDMQCFHIESRGWN 236
            |:.::.|     ..:..|..|:|      ||:|.|||......:...:...:.:|.:|:.|..|.
 Frog    53 ILTKAQWGGRAATCRTAMTTPVP------YVIIHHTAGAHCSSQTSCISQAKSIQNYHMNSNAWC 111

  Fly   237 DIAYNFLVGCDGNIYEGRGWKTVGAHTLGYNRISLGISFIGCFMKELPTADALNMCRNLLARGVE 301
            |:.|:||||.|||:||||||.:||||...||..|:|||.:|.:....|...|.|..:||::.||.
 Frog   112 DVGYSFLVGEDGNVYEGRGWNSVGAHAPNYNSNSIGISVMGTYTNINPNTAAQNAVKNLISCGVT 176

  Fly   302 DGHISTDYRLICHCQCNSTESPGRRLYEEIQTWPHF 337
            .|:|.:.|.|..|....|||.||...|..::|||.|
 Frog   177 KGYIKSTYILKGHRNVGSTECPGNTFYNTVKTWPRF 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LENP_001245695.1 PGRP 175..317 CDD:128941 53/144 (37%)
pglyrp1XP_012823786.1 PGRP 51..192 CDD:128941 53/144 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.