DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LE and Pglyrp3

DIOPT Version :9

Sequence 1:NP_001245695.1 Gene:PGRP-LE / 32534 FlyBaseID:FBgn0030695 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001178890.1 Gene:Pglyrp3 / 499658 RGDID:1593164 Length:339 Species:Rattus norvegicus


Alignment Length:173 Identity:73/173 - (42%)
Similarity:113/173 - (65%) Gaps:3/173 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 QKFKIPKELSA-IIPRSSWLAQKPMDEPLPLQLPVKYVVILHTATESSEKRAINVRLIRDMQCFH 229
            |..:|||:... ||||::|.|::  .....:.||.|:|:|:|||.||..:.|..:..:||.|.||
  Rat   167 QHSEIPKKACPNIIPRTAWEARE--THCSQMNLPAKFVIIIHTAGESCNESADCLIRVRDTQSFH 229

  Fly   230 IESRGWNDIAYNFLVGCDGNIYEGRGWKTVGAHTLGYNRISLGISFIGCFMKELPTADALNMCRN 294
            ::.:.:.||||:||||.||.:|||.||...|:||.|||.|:|||:|:|.|:::.|...:|...::
  Rat   230 MDKQDFCDIAYHFLVGQDGVVYEGVGWTIEGSHTYGYNDIALGIAFMGNFVEKPPNEASLEAAQS 294

  Fly   295 LLARGVEDGHISTDYRLICHCQCNSTESPGRRLYEEIQTWPHF 337
            |:...|..|:::::|.|:.|...::..|||:.||..|:|||||
  Rat   295 LIQCAVAMGYLASNYLLMGHSDVSNILSPGQALYNIIKTWPHF 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LENP_001245695.1 PGRP 175..317 CDD:128941 58/142 (41%)
Pglyrp3NP_001178890.1 PGRP 19..152 CDD:128941
PGRP 177..317 CDD:128941 58/141 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345833
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5479
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.710

Return to query results.
Submit another query.