DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LE and PGRP-LB

DIOPT Version :9

Sequence 1:NP_001245695.1 Gene:PGRP-LE / 32534 FlyBaseID:FBgn0030695 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001247052.1 Gene:PGRP-LB / 41379 FlyBaseID:FBgn0037906 Length:255 Species:Drosophila melanogaster


Alignment Length:175 Identity:74/175 - (42%)
Similarity:97/175 - (55%) Gaps:14/175 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 IIPRSSWLAQKPMDEPLPLQLPVKYVVILHT-------ATESSEKRAINVRLIRDMQCFHIESRG 234
            ::.||.|.|:.|.... ..|.|..||:|.|:       :|....|.      :||||.||...||
  Fly    55 LLSRSDWGARLPKSVE-HFQGPAPYVIIHHSYMPAVCYSTPDCMKS------MRDMQDFHQLERG 112

  Fly   235 WNDIAYNFLVGCDGNIYEGRGWKTVGAHTLGYNRISLGISFIGCFMKELPTADALNMCRNLLARG 299
            ||||.|:|.:|.||.||.|||:..:|||...||..|:||..||.:..|||....|:..:||:|.|
  Fly   113 WNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFG 177

  Fly   300 VEDGHISTDYRLICHCQCNSTESPGRRLYEEIQTWPHFYNIEEEE 344
            |..|:|...|:|:.|.|...||.||.||:.||.:||||.:|.:.|
  Fly   178 VFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTHINDTE 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LENP_001245695.1 PGRP 175..317 CDD:128941 59/146 (40%)
PGRP-LBNP_001247052.1 PGRP 53..195 CDD:128941 59/146 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.