DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LE and PGRP-LA

DIOPT Version :9

Sequence 1:NP_001245695.1 Gene:PGRP-LE / 32534 FlyBaseID:FBgn0030695 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_996026.1 Gene:PGRP-LA / 39062 FlyBaseID:FBgn0035975 Length:368 Species:Drosophila melanogaster


Alignment Length:315 Identity:85/315 - (26%)
Similarity:131/315 - (41%) Gaps:77/315 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 SIQTLGNVNISNSTNVHIGNVTNINGNIQI------------IADGLTQNRRD-RRHVSPPRDNA 138
            :||....:|:::||:|.||.:|...|.:.|            .|.|:..|..: ..:.:..||.:
  Fly    55 AIQPSSVINLNHSTDVVIGPMTQYQGPVSIYYMDYMEAHAMQTAAGINSNNANGNGNANRSRDKS 119

  Fly   139 PKTPTHFEDDYQDESEERVRSDVF-------------------IRRQKFKIPKELS--------- 175
            |             |....|:.:.                   :.|.|.::|...:         
  Fly   120 P-------------SRRVTRNTILLITLILLVLATGLIVLYVELNRPKPELPSNKAIYFGNNYDH 171

  Fly   176 ----------AIIPRSSWLAQKPMDE-PLPLQLPVKYVVILHTATESSE-----KRAINVRLIRD 224
                      .::.|..|.|.|.... .:||:.|:.||:|.|...:|..     |.:|.:|.|:|
  Fly   172 QTFPNLGNGHLVVDREQWGASKNSHGLTIPLKRPIPYVLITHIGVQSLPCDNIYKCSIKMRTIQD 236

  Fly   225 MQCFHIESRGWNDIAYNFLVGCDGNIYEGRGWKTVGAHTLGYNRISLGISFIGCFMKELPTADAL 289
            ..   |..:|..||..||.|..:||||.||||.  .|:|  |...:|.|:|:|.:.:..|....|
  Fly   237 SA---IAEKGLPDIQSNFYVSEEGNIYVGRGWD--WANT--YANQTLAITFMGDYGRFKPGPKQL 294

  Fly   290 NMCRNLLARGVEDGHISTDYRLICHCQCNSTESPGRRLYEEIQTWPHFYNIEEEE 344
            ...:.|||..|.:.:|..||:|:...|...|.|||..:|:||:.|||||....:|
  Fly   295 EGVQFLLAHAVANRNIDVDYKLVAQNQTKVTRSPGAYVYQEIRNWPHFYGCGMDE 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LENP_001245695.1 PGRP 175..317 CDD:128941 49/166 (30%)
PGRP-LANP_996026.1 PGRP 181..322 CDD:128941 49/147 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5479
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.