DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LE and PGRP-SD

DIOPT Version :9

Sequence 1:NP_001245695.1 Gene:PGRP-LE / 32534 FlyBaseID:FBgn0030695 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_648145.1 Gene:PGRP-SD / 38858 FlyBaseID:FBgn0035806 Length:186 Species:Drosophila melanogaster


Alignment Length:167 Identity:57/167 - (34%)
Similarity:91/167 - (54%) Gaps:12/167 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 IIPRSSWLAQKP------MDEPLPLQLPVKYVVILHTATESSEKRAINVRLIRDMQCFHIESRGW 235
            |:.|:.|.|:.|      |:.|||      ..||.|||..:........:.::::|.|.:..:.:
  Fly    22 IVTRAEWNAKPPNGAIDSMETPLP------RAVIAHTAGGACADDVTCSQHMQNLQNFQMSKQKF 80

  Fly   236 NDIAYNFLVGCDGNIYEGRGWKTVGAHTLGYNRISLGISFIGCFMKELPTADALNMCRNLLARGV 300
            :||.|::|:|.:|.:||||.....||.....|..||||:|||.|.:..|..:||:..:.||.:.|
  Fly    81 SDIGYHYLIGGNGKVYEGRSPSQRGAFAGPNNDGSLGIAFIGNFEERAPNKEALDAAKELLEQAV 145

  Fly   301 EDGHISTDYRLICHCQCNSTESPGRRLYEEIQTWPHF 337
            :...:...|:|:.|.|.::|:|||..||..||.||::
  Fly   146 KQAQLVEGYKLLGHRQVSATKSPGEALYALIQQWPNW 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LENP_001245695.1 PGRP 175..317 CDD:128941 46/145 (32%)
PGRP-SDNP_648145.1 PGRP 20..162 CDD:128941 46/145 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440230
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5479
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7191
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.