DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LE and Pglyrp4

DIOPT Version :9

Sequence 1:NP_001245695.1 Gene:PGRP-LE / 32534 FlyBaseID:FBgn0030695 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001159440.1 Gene:Pglyrp4 / 384997 MGIID:2686324 Length:375 Species:Mus musculus


Alignment Length:183 Identity:75/183 - (40%)
Similarity:101/183 - (55%) Gaps:11/183 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 DVFIRRQKFKIPKELSA-IIPRSSWLAQKPMDEPLPLQLPVKYVVILHTA----TESSEKRAINV 219
            |..:..||.|..|.... |:|||.|.|:.  .....:.||.||.:|||||    ::..|.|.   
Mouse   197 DCLVPPQKGKQKKAACPHIVPRSVWGARD--SHCSRMTLPAKYAIILHTAGRTCSQPDECRL--- 256

  Fly   220 RLIRDMQCFHIESRGWNDIAYNFLVGCDGNIYEGRGWKTVGAHTLGYNRISLGISFIGCFMKELP 284
             |:||:|.|.:......||.||||||.||.:|||.||...|:.|..||.|||.|:|:|.|....|
Mouse   257 -LVRDLQSFFMNRLNACDIGYNFLVGQDGGVYEGVGWNNQGSKTDSYNDISLSITFMGTFTGSPP 320

  Fly   285 TADALNMCRNLLARGVEDGHISTDYRLICHCQCNSTESPGRRLYEEIQTWPHF 337
            .|.||...::|:...|..|:::.:|.|:.|...::|.|||:.||..|:|||||
Mouse   321 NAAALEAAQDLIRCAVVKGYLTPNYLLMGHSDVSNTLSPGQALYNIIKTWPHF 373

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
PGRP-LENP_001245695.1 PGRP 175..317 CDD:128941 58/146 (40%)
Pglyrp4NP_001159440.1 PGRP 58..192 CDD:128941
PGRP 213..353 CDD:128941 58/145 (40%)
Interaction with murein. /evidence=ECO:0000250 295..304 3/8 (38%)