DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LE and PGRP-LD

DIOPT Version :9

Sequence 1:NP_001245695.1 Gene:PGRP-LE / 32534 FlyBaseID:FBgn0030695 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001137893.1 Gene:PGRP-LD / 3771920 FlyBaseID:FBgn0260458 Length:327 Species:Drosophila melanogaster


Alignment Length:141 Identity:33/141 - (23%)
Similarity:60/141 - (42%) Gaps:12/141 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 PVKYVVILHTATESSEKRAINVRLIRDMQCFHIESRGWNDIAYNFLVGCDGNIYEGRGWKTVGAH 262
            |:....::.|.|.|:|.......::..::..|:     .::.|||||..|..::|.:||.....:
  Fly   191 PIGVGTVIFTHTGSNECHDDCPDVLHKLERSHV-----GELPYNFLVAGDCQVFEAQGWHYRSQY 250

  Fly   263 TLGYNRI-SLGISFIGCFMKELPTADALNMCRNLLARGVEDGHISTDYRLICHCQCNSTESPGRR 326
            ....|.| ||.::|:|.|....|....|...:.|:...::...:...|:|..      ..|....
  Fly   251 PRDLNGIDSLVMAFVGNFSGRPPIDCQLMAAQALILESLKRRILQPIYQLFV------LGSYTDA 309

  Fly   327 LYEEIQTWPHF 337
            |..|::.|||:
  Fly   310 LQRELRHWPHY 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LENP_001245695.1 PGRP 175..317 CDD:128941 27/119 (23%)
PGRP-LDNP_001137893.1 PGRP 169..306 CDD:128941 27/125 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440228
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.