DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LE and PGRP-SC1a

DIOPT Version :9

Sequence 1:NP_001245695.1 Gene:PGRP-LE / 32534 FlyBaseID:FBgn0030695 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_610407.1 Gene:PGRP-SC1a / 35859 FlyBaseID:FBgn0043576 Length:185 Species:Drosophila melanogaster


Alignment Length:139 Identity:56/139 - (40%)
Similarity:85/139 - (61%) Gaps:0/139 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 VKYVVILHTATESSEKRAINVRLIRDMQCFHIESRGWNDIAYNFLVGCDGNIYEGRGWKTVGAHT 263
            :.|.:|.|||....|.||....:::.:|.:|::|.||.||.||||:|.|||:||||||..:|||.
  Fly    45 LSYAIIHHTAGSYCETRAQCNAVLQSVQNYHMDSLGWPDIGYNFLIGGDGNVYEGRGWNNMGAHA 109

  Fly   264 LGYNRISLGISFIGCFMKELPTADALNMCRNLLARGVEDGHISTDYRLICHCQCNSTESPGRRLY 328
            ..:|..|:||||:|.:..:....:.::..:.||...|..|.:|:.|.|..|.|.::||.||..::
  Fly   110 AEWNPYSIGISFLGNYNWDTLEPNMISAAQQLLNDAVNRGQLSSGYILYGHRQVSATECPGTHIW 174

  Fly   329 EEIQTWPHF 337
            .||:.|.|:
  Fly   175 NEIRGWSHW 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LENP_001245695.1 PGRP 175..317 CDD:128941 47/117 (40%)
PGRP-SC1aNP_610407.1 PGRP 22..163 CDD:128941 47/117 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440264
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.