DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LE and Pglyrp2

DIOPT Version :9

Sequence 1:NP_001245695.1 Gene:PGRP-LE / 32534 FlyBaseID:FBgn0030695 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_038935975.1 Gene:Pglyrp2 / 299567 RGDID:1359183 Length:522 Species:Rattus norvegicus


Alignment Length:172 Identity:70/172 - (40%)
Similarity:98/172 - (56%) Gaps:9/172 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 AIIPRSSWLAQKPMDEPLPLQLPVKYVVILHTATESS-----EKRAINVRLIRDMQCFHIESRGW 235
            ||.||..|.|......|.||:||:..:.:.||...:.     :..|.:   :|.||.||...|||
  Rat   353 AIHPRCRWGAAPYRGHPTPLRLPLGLLYVHHTYVPAPPCTTFQSCAAD---MRSMQRFHQNVRGW 414

  Fly   236 NDIAYNFLVGCDGNIYEGRGWKTVGAHTLGYNRISLGISFIGCFMKELPTADALNMCRNLL-ARG 299
            .||.|:|:||.||.:|:||||..|||||||||....|::|:|.:...||:..|||..|::| :..
  Rat   415 ADIGYSFVVGSDGYVYQGRGWHWVGAHTLGYNSRGFGVAFVGNYTGSLPSEAALNTVRDVLPSCA 479

  Fly   300 VEDGHISTDYRLICHCQCNSTESPGRRLYEEIQTWPHFYNIE 341
            :..|.:..||:|..|.|...|:.||..|:..::|||||..:|
  Rat   480 IRAGLLRPDYKLFGHRQLGKTDCPGNALFNLLRTWPHFTVVE 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LENP_001245695.1 PGRP 175..317 CDD:128941 59/146 (40%)
Pglyrp2XP_038935975.1 PGRP 352..497 CDD:128941 59/146 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345853
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.