DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LE and Pglyrp3

DIOPT Version :9

Sequence 1:NP_001245695.1 Gene:PGRP-LE / 32534 FlyBaseID:FBgn0030695 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_006501534.1 Gene:Pglyrp3 / 242100 MGIID:2685266 Length:359 Species:Mus musculus


Alignment Length:176 Identity:74/176 - (42%)
Similarity:114/176 - (64%) Gaps:9/176 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 QKFKIPKELSA-IIPRSSWLAQK---PMDEPLPLQLPVKYVVILHTATESSEKRAINVRLIRDMQ 226
            |..:|||:... |.|||:|.|::   |.     :.||.|:|:|:|||.:|..:.|..:..:||.|
Mouse   187 QHSEIPKKACPNITPRSAWEARETHCPQ-----MNLPAKFVIIIHTAGKSCNESADCLVRVRDTQ 246

  Fly   227 CFHIESRGWNDIAYNFLVGCDGNIYEGRGWKTVGAHTLGYNRISLGISFIGCFMKELPTADALNM 291
            .|||:::.:.||||:||||.||.:|||.||...|:||.|||.|:|||:|:|.|:::.|...:|..
Mouse   247 SFHIDNQDFCDIAYHFLVGQDGEVYEGVGWNIEGSHTYGYNDIALGIAFMGNFVEKPPNEASLKA 311

  Fly   292 CRNLLARGVEDGHISTDYRLICHCQCNSTESPGRRLYEEIQTWPHF 337
            .::|:...|..|:::::|.|:.|...::..|||:.||..|:|||||
Mouse   312 AQSLIQCAVAKGYLTSNYLLMGHSDVSNILSPGQALYNIIKTWPHF 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LENP_001245695.1 PGRP 175..317 CDD:128941 59/145 (41%)
Pglyrp3XP_006501534.1 PGRP 40..172 CDD:128941
PGRP 197..337 CDD:128941 59/144 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842402
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5479
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7191
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.650

Return to query results.
Submit another query.