DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LE and Pglyrp1

DIOPT Version :9

Sequence 1:NP_001245695.1 Gene:PGRP-LE / 32534 FlyBaseID:FBgn0030695 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_033428.1 Gene:Pglyrp1 / 21946 MGIID:1345092 Length:182 Species:Mus musculus


Alignment Length:171 Identity:75/171 - (43%)
Similarity:102/171 - (59%) Gaps:16/171 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 SAIIPRSSWLAQKPMDEPLPLQLPVKYVVILHTA------TESSEKRAINVRLIRDMQCFHIESR 233
            |.|:|||.|.| .|.:....|..||:||||.|||      .:|.|::|      |::|.:|....
Mouse    18 SFIVPRSEWRA-LPSECSSRLGHPVRYVVISHTAGSFCNSPDSCEQQA------RNVQHYHKNEL 75

  Fly   234 GWNDIAYNFLVGCDGNIYEGRGWKTVGAHTLG--YNRISLGISFIGCFMKELPTADALNMCRNLL 296
            ||.|:|||||:|.||::||||||...|.|| |  :|.:|:||:|:|.||..:|...||....|||
Mouse    76 GWCDVAYNFLIGEDGHVYEGRGWNIKGDHT-GPIWNPMSIGITFMGNFMDRVPAKRALRAALNLL 139

  Fly   297 ARGVEDGHISTDYRLICHCQCNSTESPGRRLYEEIQTWPHF 337
            ..||..|.:.::|.:..|....||.|||.:||:.||:|.|:
Mouse   140 ECGVSRGFLRSNYEVKGHRDVQSTLSPGDQLYQVIQSWEHY 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LENP_001245695.1 PGRP 175..317 CDD:128941 64/149 (43%)
Pglyrp1NP_033428.1 PGRP 20..160 CDD:128941 63/147 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842392
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5479
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.710

Return to query results.
Submit another query.