DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LE and mig-39

DIOPT Version :9

Sequence 1:NP_001245695.1 Gene:PGRP-LE / 32534 FlyBaseID:FBgn0030695 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_498871.3 Gene:mig-39 / 185686 WormBaseID:WBGene00018369 Length:943 Species:Caenorhabditis elegans


Alignment Length:300 Identity:62/300 - (20%)
Similarity:114/300 - (38%) Gaps:72/300 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 TEEEEDADQNTSEEISTMTLGTQI-ATKKHSIISDTIR---DLMNSINSIQTLGNVNISNSTNVH 103
            ||.:.:...|::......:|.:|: |:||.:::.|..:   |:.....|:...|....|..|.|.
 Worm   457 TESQYEHIVNSTSHKLIQSLKSQLSASKKLNLLLDITKITADISRVTVSVALTGGAGNSYETQVI 521

  Fly   104 IGNVTNINGN----IQIIADGLTQNRRDRRHVSPPRDNAPKTPTHFEDDYQDESEERVRSDVFIR 164
            :....|||||    :..:.:.:.|:    .::||...|                 ..:.|.:...
 Worm   522 LLAFRNINGNQSEDLTAVFEKVLQD----YNISPSSIN-----------------RVICSGLNEL 565

  Fly   165 RQKFKIPKELSAIIPR-----SSWLAQKPMDEPLP---LQLPVKYVVILHTATESSE--KRAINV 219
            .:..::||::.:...|     .|||...|..|.|.   ..:.|.|:.:......:|:  |....|
 Worm   566 AEPAELPKQMDSFSSRLANCFKSWLETSPTVEVLKKNVYAMLVSYLTVPAAIQLASQMLKAKFEV 630

  Fly   220 RLIRDMQCFHIESRGWNDIAYNFLVGCDGNIY----EG------RGW-KTVGAHTLGYNRISLGI 273
            .|   .:.||:       |..:.:...|  ||    ||      |.| |..|.|.|    :::..
 Worm   631 PL---TEPFHV-------IVEHLVAHRD--IYQMNMEGITLISEREWNKVTGIHHL----MNIFK 679

  Fly   274 SFIGCFMKELPTAD----ALNMCRNLLARGVED-GHISTD 308
            .|: .:..::.|.|    .:...:|:|.:.:.. |.|.:|
 Worm   680 PFM-TYSTDMTTVDTVIPTIVQIQNVLEKDIYHLGDIGSD 718

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LENP_001245695.1 PGRP 175..317 CDD:128941 34/159 (21%)
mig-39NP_498871.3 Dimer_Tnp_hAT <866..>902 CDD:283379
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.