DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LE and PGLYRP3

DIOPT Version :9

Sequence 1:NP_001245695.1 Gene:PGRP-LE / 32534 FlyBaseID:FBgn0030695 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_011507420.1 Gene:PGLYRP3 / 114771 HGNCID:30014 Length:377 Species:Homo sapiens


Alignment Length:305 Identity:95/305 - (31%)
Similarity:152/305 - (49%) Gaps:59/305 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 KKHSIISDTIRDLMNSINSIQTLG------NVNISNSTNVHIGNVTNING-------NIQI---- 116
            ::.|:.|..:|.|.:  :|:.|:|      |..:.:...|:.|...||.|       ||.:    
Human    94 QQQSVCSQMLRGLQS--HSVYTIGWCDVAYNFLVGDDGRVYEGVGWNIQGLHTQGYNNISLGIAF 156

  Fly   117 ---------------IADGLTQNRRDRRHVSPPRDNAPKTPTHFEDDYQDESEERVRSDVFIRRQ 166
                           .|:||......:.|:| ||...|..               ::.:..:..|
Human   157 FGNKIGSSPSPAALSAAEGLISYAIQKGHLS-PRYIQPLL---------------LKEETCLDPQ 205

  Fly   167 KFKIPKELSA-IIPRSSWLAQK---PMDEPLPLQLPVKYVVILHTATESSEKRAINVRLIRDMQC 227
            ...:|:::.. ||.||:|.|::   |     .:.||.|||:|:|||..|.........::|::|.
Human   206 HPVMPRKVCPNIIKRSAWEARETHCP-----KMNLPAKYVIIIHTAGTSCTVSTDCQTVVRNIQS 265

  Fly   228 FHIESRGWNDIAYNFLVGCDGNIYEGRGWKTVGAHTLGYNRISLGISFIGCFMKELPTADALNMC 292
            ||:::|.:.||.|:||||.||.:|||.||...|:||.|:|.|:|||:|||.|:::.|.|.||...
Human   266 FHMDTRNFCDIGYHFLVGQDGGVYEGVGWHIQGSHTYGFNDIALGIAFIGYFVEKPPNAAALEAA 330

  Fly   293 RNLLARGVEDGHISTDYRLICHCQCNSTESPGRRLYEEIQTWPHF 337
            ::|:...|.:|:::.:|.|:.|....:..|||:.||..|.|||||
Human   331 QDLIQCAVVEGYLTPNYLLMGHSDVVNILSPGQALYNIISTWPHF 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LENP_001245695.1 PGRP 175..317 CDD:128941 59/145 (41%)
PGLYRP3XP_011507420.1 PGRP 57..195 CDD:128941 23/103 (22%)
PGRP 215..355 CDD:128941 59/144 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152335
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7191
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.800

Return to query results.
Submit another query.