DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LE and PGLYRP2

DIOPT Version :9

Sequence 1:NP_001245695.1 Gene:PGRP-LE / 32534 FlyBaseID:FBgn0030695 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001350475.1 Gene:PGLYRP2 / 114770 HGNCID:30013 Length:634 Species:Homo sapiens


Alignment Length:168 Identity:68/168 - (40%)
Similarity:96/168 - (57%) Gaps:9/168 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 AIIPRSSWLAQKPMDEPLPLQLPVKYVVILHTATESS-----EKRAINVRLIRDMQCFHIESRGW 235
            ||.||..|.|......|..||||:.::.:.||...:.     .:.|.|   :|.||.:|.:::||
Human   381 AIHPRCRWGAAPYRGRPKLLQLPLGFLYVHHTYVPAPPCTDFTRCAAN---MRSMQRYHQDTQGW 442

  Fly   236 NDIAYNFLVGCDGNIYEGRGWKTVGAHTLGYNRISLGISFIGCFMKELPTADALNMCRNLL-ARG 299
            .||.|:|:||.||.:||||||..|||||||:|....|::.:|.:...|||..||...|:.| :..
Human   443 GDIGYSFVVGSDGYVYEGRGWHWVGAHTLGHNSRGFGVAIVGNYTAALPTEAALRTVRDTLPSCA 507

  Fly   300 VEDGHISTDYRLICHCQCNSTESPGRRLYEEIQTWPHF 337
            |..|.:..||.|:.|.|...|:.||..|::.::|||||
Human   508 VRAGLLRPDYALLGHRQLVRTDCPGDALFDLLRTWPHF 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LENP_001245695.1 PGRP 175..317 CDD:128941 58/146 (40%)
PGLYRP2NP_001350475.1 PGRP 380..525 CDD:128941 58/146 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152345
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.