DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LE and pglyrp2

DIOPT Version :9

Sequence 1:NP_001245695.1 Gene:PGRP-LE / 32534 FlyBaseID:FBgn0030695 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001106487.2 Gene:pglyrp2 / 100127677 XenbaseID:XB-GENE-5779913 Length:497 Species:Xenopus tropicalis


Alignment Length:386 Identity:109/386 - (28%)
Similarity:162/386 - (41%) Gaps:90/386 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSESGIKKLSQERTREWLASQEDEELESIAESSVVDSLDYDYTEEEEDADQNTSEEISTMTLGTQ 65
            |||:   |.:.....:||.|  :::.:||..||:..||...:                   |...
 Frog   150 MSEA---KKTNNSCAQWLHS--NDKKDSIHSSSLTISLGLAF-------------------LDPD 190

  Fly    66 IATKKHSIISDTIRDLMNSINSIQ----------TLGNVNISNSTNVHIGNVTN---INGNIQII 117
            :|..||....|...|.::...:.|          ||..:|.:....: :|.:..   ..||:..:
 Frog   191 VALHKHLAAVDGCWDSVSDPRTFQLQNAPCHPGLTLAFLNGALDGTL-LGEMIRQVPKGGNLSSL 254

  Fly   118 ADGLTQNRRDRRHVSPPRDNAPKTPTHFEDDYQ----DESEERV--------------RSDVFIR 164
            ..|.......|             ..:...|:|    ..|.||:              ||...|.
 Frog   255 LQGYYWGNTSR-------------SLYRRQDFQAILAGHSLERLIQKAIYCYRNMEAGRSLRNIT 306

  Fly   165 RQKFKIPK------------ELSAIIPRSSWLAQKPMDEPLPLQLPVKYVVILHTATESS----- 212
            .::.||..            :..|:|||..|.|::...:|:.|.||:..|.|.||...|.     
 Frog   307 EEQIKIAAGAAAREFEQYFLDCPAVIPRCMWGAKRYKGKPIFLGLPLSRVFIHHTYEPSQPCTSF 371

  Fly   213 EKRAINVRLIRDMQCFHIESRGWNDIAYNFLVGCDGNIYEGRGWKTVGAHTLGYNRISLGISFIG 277
            .:.|.|   :|.||.||.:.|||:||.|:|:||.:|.:||||||...||||.|||.:..|:||||
 Frog   372 SQCAAN---MRSMQRFHQQDRGWDDIGYSFVVGSNGYLYEGRGWNRAGAHTRGYNSVGYGVSFIG 433

  Fly   278 CFMKELPTADALNMCRNLLAR-GVEDGHISTDYRLICHCQCNSTESPGRRLYEEIQTWPHF 337
            .:...:|....|.:.::...| .|..|:|:.:|.:..|.|..||..||..||:|||:|.||
 Frog   434 DYTSIVPKDSILALVKDRFLRCAVRLGYITPNYIIQGHRQVVSTSCPGDALYKEIQSWDHF 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LENP_001245695.1 PGRP 175..317 CDD:128941 58/147 (39%)
pglyrp2NP_001106487.2 PGRP 329..474 CDD:128941 58/147 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.