DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15602 and VPS27

DIOPT Version :9

Sequence 1:NP_001285298.1 Gene:CG15602 / 32533 FlyBaseID:FBgn0030694 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_014403.3 Gene:VPS27 / 855739 SGDID:S000005289 Length:622 Species:Saccharomyces cerevisiae


Alignment Length:329 Identity:71/329 - (21%)
Similarity:135/329 - (41%) Gaps:85/329 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SCFGCGRKYGLFCKEYGCPNCGYSFCSKCLKRPMPVP----RHAGKVHNVCLICYDKLSKLQASA 62
            :|..|.:|:.|..:::.|.:||..||.:.....:|:|    ....:|.:.|...||    |:...
Yeast   175 ACMICSKKFSLLNRKHHCRSCGGVFCQEHSSNSIPLPDLGIYEPVRVCDSCFEDYD----LKRHD 235

  Fly    63 DAEKVIDCDALPGILVTKMNLAPPSKSSDGADALFNDSLPVEELPQALVP--------SSSSSP- 118
            |::|            :|.:.....|..|     ::.....|||.:..:.        |:||.| 
Yeast   236 DSKK------------SKKHRHKRKKDRD-----YSTPEDEEELIRKAIELSLKESRNSASSEPI 283

  Fly   119 ----HSKDH--KDHIDENLDSELTKRMQDYKRVDATDDEIRTRLANLTGM-------PHTKSYDK 170
                .||:.  :..|:|..|.:|...:|:..| :|.:.::|:.....:..       |..:....
Yeast   284 VPVVESKNEVKRQEIEEEEDPDLKAAIQESLR-EAEEAKLRSERQKASRQMQPQQPSPQPQPIHS 347

  Fly   171 KDLLLSTDQRNDQ--------EKMRDL-LAQFVDEAQLDQNISRQRDDSISDIERRLR-ALRD-- 223
            .||   :|:..|.        |||:.. |.:.:::::| ||::::    :...:.||. ||.|  
Yeast   348 VDL---SDEEKDSIYMFASLVEKMKSRPLNEILEDSKL-QNLAQR----VFASKARLNYALNDKA 404

  Fly   224 ----TPVDSDACPSRSQMESIADNEEDDETLLQNILKKYVAESRLPE-PSESEISPIN--TESPG 281
                |.::.:.  ..|::.:|.|...:.:....|:.::|.    ||: ||:    |.|  ||:..
Yeast   405 QKYNTLIEMNG--KISEIMNIYDRLLEQQLQSINLSQQYT----LPQVPSD----PYNYLTENVQ 459

  Fly   282 NTEE 285
            |..|
Yeast   460 NPAE 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15602NP_001285298.1 PHD_SF 2..52 CDD:304600 13/53 (25%)
VPS27NP_014403.3 VHS_Vps27 7..149 CDD:340776
FYVE_like_SF 169..226 CDD:333710 12/50 (24%)
GAT_Vps27 349..432 CDD:410590 20/92 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1818
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.