DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15602 and ZFYVE19

DIOPT Version :9

Sequence 1:NP_001285298.1 Gene:CG15602 / 32533 FlyBaseID:FBgn0030694 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001070736.1 Gene:ZFYVE19 / 84936 HGNCID:20758 Length:471 Species:Homo sapiens


Alignment Length:424 Identity:116/424 - (27%)
Similarity:167/424 - (39%) Gaps:117/424 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CFGCGRKYGLFCKEYGCPNCGYSFCSKCLKRPMPVPRHAGKVHNVCLICYDKLSKLQASADAEKV 67
            |:||..|:.||.|||||.|||.:|||.||.....|||.......||..|::.|:: .:||:|.| 
Human    80 CYGCAVKFTLFKKEYGCKNCGRAFCSGCLSFSAAVPRTGNTQQKVCKQCHEVLTR-GSSANASK- 142

  Fly    68 IDCDALPGILVTKMNLAPPSKSSDGADALFNDSLPVEELPQALVPSSSSSPHSKDHKDHIDENLD 132
                           .:||........||        |..|.  ||:|.|.........|.|.| 
Human   143 ---------------WSPPQNYKKRVAAL--------EAKQK--PSTSQSQGLTRQDQMIAERL- 181

  Fly   133 SELTKRMQDYKRVDATDDEIRTRLANLT-----GMPHTKSYDKKDLLL---------------ST 177
              ...|.::..::..:..||..|||.|.     .:|.|:..:.:...|               :.
Human   182 --ARLRQENKPKLVPSQAEIEARLAALKDERQGSIPSTQEMEARLAALQGRVLPSQTPQPAHHTP 244

  Fly   178 DQRNDQEKMRDLLAQFVDEAQLDQ-----------------------NISRQRDDSISDIERRLR 219
            |.|...::.:|||.|...|..:|:                       |..||.:.|:.:.:.||.
Human   245 DTRTQAQQTQDLLTQLAAEVAIDESWKGGGPAASLQNDLNQGGPGSTNSKRQANWSLEEEKSRLL 309

  Fly   220 A-----LRDTPVDSDAC--------------PSRSQMESI----ADNEEDDETLLQNILKKYVAE 261
            |     ||:.....:..              |.|..::..    :|::||:||.:|.:|::...|
Human   310 AEAALELREENTRQERILALAKRLAMLRGQDPERVTLQDYRLPDSDDDEDEETAIQRVLQQLTEE 374

  Fly   262 SRLPEPS-------------------ESEISPINTESPGNTEELPWCNICNEDADFRCHGCGGEL 307
            :.|.|.|                   |.|...::.......||||||.||||||..||.||.|:|
Human   375 ASLDEASGFNIPAEQASRPWTQPRGAEPEAQDVDPRPEAEEEELPWCCICNEDATLRCAGCDGDL 439

  Fly   308 FCTLCYKECHDDDEEYRAHVKEKYSAPPKLKENH 341
            ||..|::|.| |..|.:.|....|| ||:..:.|
Human   440 FCARCFREGH-DAFELKEHQTSAYS-PPRAGQEH 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15602NP_001285298.1 PHD_SF 2..52 CDD:304600 24/48 (50%)
ZFYVE19NP_001070736.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..64
FYVE_ZFY19 79..129 CDD:277288 24/48 (50%)
MIM1-A 174..187 4/15 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 271..299 3/27 (11%)
MIM1-B 326..339 0/12 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 386..412 2/25 (8%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1818
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12435
Inparanoid 1 1.050 128 1.000 Inparanoid score I4683
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47533
OrthoDB 1 1.010 - - D1355078at2759
OrthoFinder 1 1.000 - - FOG0006837
OrthoInspector 1 1.000 - - oto88486
orthoMCL 1 0.900 - - OOG6_108323
Panther 1 1.100 - - LDO PTHR46603
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5059
SonicParanoid 1 1.000 - - X5729
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.870

Return to query results.
Submit another query.