DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15602 and AT1G69710

DIOPT Version :9

Sequence 1:NP_001285298.1 Gene:CG15602 / 32533 FlyBaseID:FBgn0030694 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_177129.2 Gene:AT1G69710 / 843307 AraportID:AT1G69710 Length:1041 Species:Arabidopsis thaliana


Alignment Length:323 Identity:65/323 - (20%)
Similarity:118/323 - (36%) Gaps:70/323 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CFGCGRKYGLFCKEYGCPNCGYSFCSKCLKRP---MPVPRHAGKVHNVCLICYDKLSKLQASADA 64
            |.||...:....|.:.|.|||..||..|..|.   ..:.....|.:.||..|:.||.|.:.|:.:
plant   657 CAGCRNPFNFRRKRHNCYNCGLVFCKVCSSRKSLRAALAPDMNKPYRVCYGCFTKLKKSRESSPS 721

  Fly    65 EKVIDCDALPGILVTKMNLAPPSKSSDGADALFNDSLPVEELP-QALVPSSSSSPHSKDHKDH-- 126
            ........|       :|:   .||:|.::   .|||..:.|. .|.:.|:.||.|..:.:.|  
plant   722 TPTSRTRKL-------LNM---RKSTDVSE---RDSLTQKFLSVNARLSSADSSLHYSERRHHRR 773

  Fly   127 ------IDENLDSELTKRMQDY-----KRVDATDDEIRTRLANLTGMPHTKSYDKKDLLLSTDQR 180
                  .:.|:...:...:|..     |...|.....:..:..:.|...:........:.||..|
plant   774 DLKPEVNNSNVFPSMNGSLQPVGSPFSKGSTALPKIPKNMMVKIPGSGMSSRTTSPVSVKSTSPR 838

  Fly   181 NDQE-------KMRDLLAQFVDEAQLDQNI------SRQRDDSISDIERRLRALRDTPVD----- 227
            ...|       :::|...|  |.|.|.:.:      :.|.::.:...:|:|:.:.....|     
plant   839 RSYEVAAAESKQLKDSFNQ--DMAGLKEQVEQLASKAHQLEEELEKTKRQLKVVTAMAADEAEEN 901

  Fly   228 --------------SDACPSRSQMESIADN-----EEDDETLLQNILKKYVAESRLPEPSESE 271
                          .:....:||.:||:.|     :|..||:.|...:.:: .|.:.:.|::|
plant   902 RSAKEVIRSLTTQLKEMAEKQSQKDSISTNSKHTDKEKSETVTQTSNQTHI-RSMVSQDSQNE 963

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15602NP_001285298.1 PHD_SF 2..52 CDD:304600 15/51 (29%)
AT1G69710NP_177129.2 PH_PLC_plant-like 25..135 CDD:270171
RCC1_2 354..381 CDD:290274
RCC1 370..422 CDD:278826
RCC1 425..474 CDD:278826
RCC1 491..537 CDD:278826
RCC1 543..591 CDD:278826
RCC1 596..643 CDD:278826
FYVE 646..714 CDD:214499 18/56 (32%)
DUF4200 838..936 CDD:290574 16/99 (16%)
BRX_N 896..>921 CDD:290432 1/24 (4%)
BRX 981..1035 CDD:285568
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.