DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15602 and Hgs

DIOPT Version :9

Sequence 1:NP_001285298.1 Gene:CG15602 / 32533 FlyBaseID:FBgn0030694 Length:342 Species:Drosophila melanogaster
Sequence 2:XP_038942636.1 Gene:Hgs / 56084 RGDID:69225 Length:860 Species:Rattus norvegicus


Alignment Length:312 Identity:61/312 - (19%)
Similarity:102/312 - (32%) Gaps:113/312 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CFGCGRKYGLFCKEYGCPNCGYSFCSKCLKRPMPVPRHA-GKVHNVCLICYDKLSKLQASADAEK 66
            |..|..::|:..:::.|..||..||.||..:...:|:.. .|...||..||::|:|   .|:.:.
  Rat   228 CHRCRVQFGVVTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNK---KAEGKA 289

  Fly    67 VIDCDALPGIL---VTKMNLAPPSKSSDGADALFNDSLPVEELPQALV----------------- 111
            ....:..|..|   :::.:..||.:..   .||..:    |||..||.                 
  Rat   290 ASTTELPPEYLTSPLSQQSQLPPKRDE---TALQEE----EELQLALALSQSEAEEKERMRQKST 347

  Fly   112 -------------------------PSSSSSPHSKDHKDHIDENLDSELTKRMQDYKRVDATDDE 151
                                     |.:||:|.::|    ||..|...|.:...:.|:.:|....
  Rat   348 YTAHPKSEPAPLASSAPPAGSLYSSPVNSSAPLAED----IDPELARYLNRNYWEKKQEEARKSP 408

  Fly   152 IRTRLANLT------GMPHTKSYDKKDLLLSTDQRNDQEKMRDLLAQFVDEAQLDQNISRQRDDS 210
            ..:....||      |..||                        ....:.||.|.:..|:     
  Rat   409 TPSAPVPLTEPAAQPGEGHT------------------------APNSMVEAPLPETDSQ----- 444

  Fly   211 ISDIERRLRALRDTPVDSDACPSRSQMESIADNEEDDETL---LQNILKKYV 259
                          |:.|.:.|...|.:: .::||..|..   |||.:..:|
  Rat   445 --------------PITSCSGPFSEQYQN-GESEESHEQFLKALQNAVSTFV 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15602NP_001285298.1 PHD_SF 2..52 CDD:304600 14/49 (29%)
HgsXP_038942636.1 VHS_Hrs 68..205 CDD:340771
FYVE_Hrs 221..281 CDD:277260 16/52 (31%)
PLN03209 <283..441 CDD:178748 32/195 (16%)
GAT_Hrs 467..562 CDD:410592 5/15 (33%)
G_path_suppress 560..809 CDD:406402
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1818
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.