DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15602 and Zfyve1

DIOPT Version :9

Sequence 1:NP_001285298.1 Gene:CG15602 / 32533 FlyBaseID:FBgn0030694 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001346095.1 Gene:Zfyve1 / 217695 MGIID:3026685 Length:777 Species:Mus musculus


Alignment Length:71 Identity:24/71 - (33%)
Similarity:31/71 - (43%) Gaps:6/71 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSCFGCGRKYGLFCKEYGCPNCGYSFCSKCLKRPMPVP-RHAGKVH-NVCLICYD----KLSKLQ 59
            :||..|...:.....::.|..||..||..|..:..||| |..|... .||..|||    :|...:
Mouse   602 LSCNQCATSFKDNDTKHHCRACGEGFCDSCSSKTRPVPERGWGPAPVRVCDSCYDARNVQLDVTE 666

  Fly    60 ASADAE 65
            |.||.|
Mouse   667 AQADDE 672

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15602NP_001285298.1 PHD_SF 2..52 CDD:304600 16/51 (31%)
Zfyve1NP_001346095.1 Bbox1_ZFYVE1_rpt1 16..63 CDD:380877
Bbox1_ZFYVE1_rpt2 69..121 CDD:380878
GBP 174..410 CDD:206650
Required for localization in the lipid droplets. /evidence=ECO:0000250|UniProtKB:Q9HBF4 416..777 24/71 (34%)
FYVE_like_SF 594..655 CDD:333710 16/52 (31%)
FYVE_ZFYV1 711..771 CDD:277273
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1818
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.