DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15602 and zfyve19

DIOPT Version :9

Sequence 1:NP_001285298.1 Gene:CG15602 / 32533 FlyBaseID:FBgn0030694 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001116959.1 Gene:zfyve19 / 100144738 XenbaseID:XB-GENE-1013586 Length:430 Species:Xenopus tropicalis


Alignment Length:444 Identity:109/444 - (24%)
Similarity:159/444 - (35%) Gaps:129/444 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CFGCGRKYGLFCKEYGCPNCGYSFCSKCLKRPMPVPRHAGKVHNVCLICYDKLSKLQASADAEKV 67
            ||||..|:.:|.||.||.:||:|||..||.....:|::......||..|::.:     |:...|.
 Frog     5 CFGCASKFSIFKKECGCKSCGHSFCGSCLGFSAVLPQYGNTKQKVCRRCHETI-----SSGGNKK 64

  Fly    68 IDCDALPGILVTKMNLAPP---SKSSDGADALFNDSLPVEELPQALVPSSSSSPHSKDHKDH-ID 128
            .|          ....:||   .|.....:|..|.|..|:..|.|....:.||.|....:|. |.
 Frog    65 ND----------PSKWSPPENYKKRVAALEAKTNQSKGVQRAPGAYSSITDSSYHGLSAEDRAIA 119

  Fly   129 ENL------------------DSELTKRMQDYKRVDATDDEIRTRLANLTGMPHTKSYDKKDLLL 175
            |.|                  :|.|....:|..|...:.:|:..|||.|.|.... |..::.:..
 Frog   120 ERLGRLREETKPKAVPSTAEIESRLKALRKDPDRHVPSAEEMEDRLAVLQGRTPV-SRTQRQVHQ 183

  Fly   176 STDQRNDQEKMRDLLAQFVDEAQLDQNI------------------------------------- 203
            ..|.|...::..|||.|..:|..:|||.                                     
 Frog   184 PPDTRTQGQRAEDLLTQLNEEVAIDQNCEEAPQSQDFSAAPKNDLNRVDGKDSWAEMDPAQLEEE 248

  Fly   204 --------------SRQRDDSISDIERRLRALRDTPVDSDACPSRSQMESIADNEEDDETLLQNI 254
                          ...|.:...:..:||..|:....|.....|....:|   :||.:|..:|.:
 Frog   249 KNKILSQAAAELKDENTRAEKFLETAKRLAVLQGKDPDKVTIDSYKLPDS---DEETEEEAIQRV 310

  Fly   255 LKKYVAESRL---------PEPSESEISPIN--------------------------TESPGNTE 284
            ||:...|..|         |:.:..|.|.:|                          .|:..:.|
 Frog   311 LKQLSEEVVLDEASGFNIPPDQNRPEASSLNMPVGNKLYLQGKVTTKSQPPAARTTPREADSDEE 375

  Fly   285 ELPWCNICNEDADFRCHGCGGELFCTLCYKECHDDDEEYRAHVKEKYSAPPKLK 338
            |||||.||||||..|||.|..:|:|..|::|.||:.:. :.|....|. |||.|
 Frog   376 ELPWCCICNEDAILRCHDCDDDLYCKRCFREGHDEFDR-KEHRTSSYK-PPKKK 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15602NP_001285298.1 PHD_SF 2..52 CDD:304600 20/48 (42%)
zfyve19NP_001116959.1 FYVE_ZFY19 4..54 CDD:277288 20/48 (42%)
TorS_sensor_domain <121..206 CDD:293930 19/85 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 109 1.000 Domainoid score I6328
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H12435
Inparanoid 1 1.050 109 1.000 Inparanoid score I4760
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1355078at2759
OrthoFinder 1 1.000 - - FOG0006837
OrthoInspector 1 1.000 - - oto102363
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5729
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.