DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8974 and RNF40

DIOPT Version :9

Sequence 1:NP_573076.1 Gene:CG8974 / 32532 FlyBaseID:FBgn0030693 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001273501.1 Gene:RNF40 / 9810 HGNCID:16867 Length:1001 Species:Homo sapiens


Alignment Length:152 Identity:37/152 - (24%)
Similarity:59/152 - (38%) Gaps:34/152 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LAE------ESSTSQLRPLGTSIPTNSTASE-----LKKSNTSYSFTGDYLSGGNKADLKGGYPF 98
            |||      |...::||.:...:..:..|.|     ||::....|.....|....|.::.     
Human   869 LAEDLKVQLEHVQTRLREIQPCLAESRAAREKESFNLKRAQEDISRLRRKLEKQRKVEVY----- 928

  Fly    99 GGTDTDTKANEKDKEKEHTADDSLYECNICLDTAKDAVVSMCGHLFCWPCLHQWLLTRPNRKLCP 163
              .|.|....|:.||.:     :...|..|....||||::.|.|:||:.|:......|  ::.||
Human   929 --ADADEILQEEIKEYK-----ARLTCPCCNTRKKDAVLTKCFHVFCFECVRGRYEAR--QRKCP 984

  Fly   164 VCKAAVDKDKVIPLYGRNSTHQ 185
            .|.||         :|.:..|:
Human   985 KCNAA---------FGAHDFHR 997

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8974NP_573076.1 RING 124..169 CDD:238093 16/44 (36%)
RNF40NP_001273501.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..146
SMC_N 231..920 CDD:330553 11/50 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 518..652
RING-HC_RNF40 945..999 CDD:319729 19/64 (30%)
RING-HC finger (C3HC4-type) 948..986 CDD:319729 14/39 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R146
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.