DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8974 and SLX8

DIOPT Version :9

Sequence 1:NP_573076.1 Gene:CG8974 / 32532 FlyBaseID:FBgn0030693 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_011041.3 Gene:SLX8 / 856852 SGDID:S000000918 Length:274 Species:Saccharomyces cerevisiae


Alignment Length:162 Identity:46/162 - (28%)
Similarity:75/162 - (46%) Gaps:18/162 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ELPSTSTGASSSSSTLSNNVSYDKIAWTRDITEPLAEESSTSQLRPLGTSIPTNSTASELKKSNT 75
            |.|..|:|   ::.||:|||   :...|.|:....|...|.|.:  |..:.||....:..|:.  
Yeast   107 EEPEASSG---NNITLTNNV---EELHTMDVLSQTANTPSASPM--LDAAPPTTKPGTNSKEQ-- 161

  Fly    76 SYSFTGDYLSGGNKADLKGGYPFGGTDTDTKANEKDKEKEHTADDSLYECNICLDTAKDAVVSMC 140
                |.|..:.....|.:.......:|.|.:...|:..||:.|... |.|.||.:..:.|::::|
Yeast   162 ----TVDLTADAIDLDAEEQQVLQISDDDFQEETKEAPKEYGAAKD-YRCPICFEPPETALMTLC 221

  Fly   141 GHLFCWPCLHQWL-LTRPNRKL--CPVCKAAV 169
            ||:||.|||.|.: .:|..|:.  |.:|::.|
Yeast   222 GHVFCCPCLFQMVNSSRTCRQFGHCALCRSKV 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8974NP_573076.1 RING 124..169 CDD:238093 17/47 (36%)
SLX8NP_011041.3 PEX10 1..264 CDD:227861 46/162 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 55 1.000 Inparanoid score I1801
Isobase 1 0.950 - 0 Normalized mean entropy S2074
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X682
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.