DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8974 and AT1G74990

DIOPT Version :9

Sequence 1:NP_573076.1 Gene:CG8974 / 32532 FlyBaseID:FBgn0030693 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_177636.1 Gene:AT1G74990 / 843837 AraportID:AT1G74990 Length:137 Species:Arabidopsis thaliana


Alignment Length:144 Identity:60/144 - (41%)
Similarity:76/144 - (52%) Gaps:21/144 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 DTKANEKDKEKEHTADDSLYECNICLDTAKDAVVSMCGHLFCWPCLHQWLLTRPNRKLCPVCKAA 168
            :|..||:|....:      :.|||||:.|::.:|::||||||||||::||........||||||.
plant     4 NTITNEEDDASNN------FGCNICLELAREPIVTLCGHLFCWPCLYKWLHYHSKSNHCPVCKAL 62

  Fly   169 VDKDKVIPLYGRNSTHQEDPRNK------VPPRPAGQRTE---PDPVPGFPGFGFGDGFHMSFGI 224
            |.:|.::||||.... ..|||:|      ||.|||..|||   |.......|..|..| |.||  
plant    63 VKEDTLVPLYGMGKP-SSDPRSKLNSGVTVPNRPAATRTETARPRLEQRHHGSSFFGG-HSSF-- 123

  Fly   225 GAFPFGFITSTLNF 238
            .|.|.|...|  ||
plant   124 AAMPTGLRFS--NF 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8974NP_573076.1 RING 124..169 CDD:238093 25/44 (57%)
AT1G74990NP_177636.1 PLN03208 6..>97 CDD:178747 42/97 (43%)
RING-HC_AtRMA_like 17..61 CDD:319659 23/43 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 78 1.000 Domainoid score I3052
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 114 1.000 Inparanoid score I2031
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 1 1.000 - - mtm1175
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X682
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.820

Return to query results.
Submit another query.