DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8974 and RMA3

DIOPT Version :9

Sequence 1:NP_573076.1 Gene:CG8974 / 32532 FlyBaseID:FBgn0030693 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_194477.2 Gene:RMA3 / 828856 AraportID:AT4G27470 Length:243 Species:Arabidopsis thaliana


Alignment Length:230 Identity:64/230 - (27%)
Similarity:95/230 - (41%) Gaps:75/230 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 TDTKANEKDKEKEHTADDSLYECNICLDTAKDAVVSMCGHLFCWPCLHQWLLTR-------PNRK 160
            |..:|||          ...::||||||||.|.||::|||||||||:::||..:       .::.
plant    32 TAGQANE----------SGCFDCNICLDTAHDPVVTLCGHLFCWPCIYKWLHVQLSSVSVDQHQN 86

  Fly   161 LCPVCKAAVDKDKVIPLYGR---------NSTHQEDPRNKVPPRPAGQRTEPDPV-------PGF 209
            .|||||:.:....::|||||         .|..|:.....:|.|||..... :|:       |..
plant    87 NCPVCKSNITITSLVPLYGRGMSSPSSTFGSKKQDALSTDIPRRPAPSALR-NPITSASSLNPSL 150

  Fly   210 PGFGFGDGFH----------------------MSF---GIGAFP-------FGFITSTLNFGEPR 242
            ........||                      |||   .||.|.       ||..|:|:  .:| 
plant   151 QHQTLSPSFHNHQYSPRGFTTTESTDLANAVMMSFLYPVIGMFGDLVYTRIFGTFTNTI--AQP- 212

  Fly   243 PPAANRGTRQYEDEQTLSK--LFSYLAVVWILWLF 275
                .:..|..:.|::|::  :|....::..|.||
plant   213 ----YQSQRMMQREKSLNRVSIFFLCCIILCLLLF 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8974NP_573076.1 RING 124..169 CDD:238093 27/51 (53%)
RMA3NP_194477.2 PLN03208 37..228 CDD:178747 58/208 (28%)
RING 43..95 CDD:238093 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12313
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X682
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.870

Return to query results.
Submit another query.