DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8974 and RMA1

DIOPT Version :9

Sequence 1:NP_573076.1 Gene:CG8974 / 32532 FlyBaseID:FBgn0030693 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001319862.1 Gene:RMA1 / 825654 AraportID:AT4G03510 Length:249 Species:Arabidopsis thaliana


Alignment Length:208 Identity:67/208 - (32%)
Similarity:95/208 - (45%) Gaps:51/208 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 DDSLYECNICLDTAKDAVVSMCGHLFCWPCLHQWLLTR--------PNRKLCPVCKAAVDKDKVI 175
            |||.::||||||:.::.||::|||||||||:|:||..:        ...:.|||||:.|....::
plant    42 DDSNFDCNICLDSVQEPVVTLCGHLFCWPCIHKWLDVQSFSTSDEYQRHRQCPVCKSKVSHSTLV 106

  Fly   176 PLYGR-NSTHQEDPRNKVPPRPAG--------------------QRTE-PDPVPG-FPGFGFGDG 217
            ||||| ..|.||:.:|.||.||.|                    ||.. ..|..| :|..|....
plant   107 PLYGRGRCTTQEEGKNSVPKRPVGPVYRLEMPNSPYASTDLRLSQRVHFNSPQEGYYPVSGVMSS 171

  Fly   218 FHMSFGIGAFP----FGFITSTLNFGE------PRPPAAN-RGT-------RQYEDEQTLSKLFS 264
            ..:|:.....|    .|.:.:|..||.      ..|...| .||       |..:.:::|.::|.
plant   172 NSLSYSAVLDPVMVMVGEMVATRLFGTRVMDRFAYPDTYNLAGTSGPRMRRRIMQADKSLGRIFF 236

  Fly   265 YL--AVVWILWLF 275
            :.  .||..|.||
plant   237 FFMCCVVLCLLLF 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8974NP_573076.1 RING 124..169 CDD:238093 25/52 (48%)
RMA1NP_001319862.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12313
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X682
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.870

Return to query results.
Submit another query.