DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8974 and AT2G42030

DIOPT Version :9

Sequence 1:NP_573076.1 Gene:CG8974 / 32532 FlyBaseID:FBgn0030693 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_181733.1 Gene:AT2G42030 / 818803 AraportID:AT2G42030 Length:425 Species:Arabidopsis thaliana


Alignment Length:103 Identity:48/103 - (46%)
Similarity:59/103 - (57%) Gaps:5/103 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 DTKANEK-DKEKEHTADDSLYECNICLDTAKDAVVSMCGHLFCWPCLHQWLLTRPNRKLCPVCKA 167
            |....|| |.||...:|.|.::|.||||.:||.||:.||||:||.||:|||.. ...|.|||||.
plant   119 DNVTEEKRDVEKSVGSDGSFFDCYICLDLSKDPVVTNCGHLYCWSCLYQWLQV-SEAKECPVCKG 182

  Fly   168 AVDKDKVIPLYGRNSTHQED---PRNKVPPRPAGQRTE 202
            .|....|.|:|||....:|.   ...|:|.||..:|||
plant   183 EVSVKTVTPIYGRGIQKRESEEVSNTKIPSRPQARRTE 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8974NP_573076.1 RING 124..169 CDD:238093 26/44 (59%)
AT2G42030NP_181733.1 PLN03208 124..>214 CDD:178747 42/90 (47%)
RING-HC_AtRMA_like 139..182 CDD:319659 25/43 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 1 1.000 - - mtm1175
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12313
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.870

Return to query results.
Submit another query.