DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8974 and PEX10

DIOPT Version :9

Sequence 1:NP_573076.1 Gene:CG8974 / 32532 FlyBaseID:FBgn0030693 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_565621.1 Gene:PEX10 / 817175 AraportID:AT2G26350 Length:381 Species:Arabidopsis thaliana


Alignment Length:125 Identity:35/125 - (28%)
Similarity:58/125 - (46%) Gaps:23/125 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 ASELKKSNTSYSFT--------GDYLSGGNKADLKGGYPFGGTDTDTKANEKDKEKEHTAD---- 119
            |..|::||.| |.|        |.|.:.|.:     |.|....:.:...:|.:|....|:|    
plant   263 AEGLRRSNLS-SITSSIQQASIGSYQTSGGR-----GLPVLNEEGNLITSEAEKGNWSTSDSTST 321

  Fly   120 DSLYECNICLDTAKDAVVSMCGHLFCWPCLHQWLLTRPNRKL-CPVCKAAVDKDKVIPLY 178
            :::.:|.:||.|.:....:.|||:|||.|:.:|.    |.|. ||:|:.......::.||
plant   322 EAVGKCTLCLSTRQHPTATPCGHVFCWSCIMEWC----NEKQECPLCRTPNTHSSLVCLY 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8974NP_573076.1 RING 124..169 CDD:238093 17/45 (38%)
PEX10NP_565621.1 Pex2_Pex12 41..268 CDD:282595 2/4 (50%)
RING 326..367 CDD:238093 17/44 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593722at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.