Protein Alignment CG8974 and Trim39

DIOPT Version :9

• Sequence 1: NP_573076.1
• Gene: CG8974 / 32532
• FlyBaseID: FBgn0030693
• Length: 277
• Species: Drosophila melanogaster
• Sequence 2: NP_001361535.1
• Gene: Trim39 / 79263
• MGIID: 1890659
• Length: 496
• Species: Mus musculus
• Alignment Length: 42
• Identity: 16/42 - (38%)
• Similarity: 24/42 - (57%)
• Gaps: 0/42 - (0%)

  Fly   125 CNICLDTAKDAVVSMCGHLFCWPCLHQWLLTRPNRKLCPVCK 166
            |::||:..|:.|:..|||.||..|:.:|.........||||:
Mouse    29 CSVCLEYLKEPVIIECGHNFCKACITRWWEDLERDFPCPVCR 70

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
CG8974	NP_573076.1	RING	124..169	CDD:238093	16/42 (38%)
Trim39	NP_001361535.1	RING-HC_TRIM39_C-IV	26..69	CDD:319515	14/39 (36%)
		Bbox2_TRIM39-like	103..146	CDD:380838
		PRK02224	<144..>294	CDD:179385
		SPRY_PRY_TRIM39	314..491	CDD:293979
		Interaction with CDKN1A. /evidence=ECO:0000250|UniProtKB:Q9HCM9	367..496

Information from Original Tools

Tool	Simple Score	Weighted Score	Original Tool Information
			BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R146
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.940