DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sordd1 and Pex10

DIOPT Version :10

Sequence 1:NP_573076.1 Gene:sordd1 / 32532 FlyBaseID:FBgn0030693 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001102875.1 Gene:Pex10 / 680424 RGDID:1591776 Length:324 Species:Rattus norvegicus


Alignment Length:53 Identity:18/53 - (33%)
Similarity:30/53 - (56%) Gaps:3/53 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 CNICLDTAKDAVVSMCGHLFCWPCLHQWLLTRPNRKLCPVCKAAVDKDKVIPL 177
            |.:||:..:.:..:.|||||||.|:.:|..|:..   ||:|:......|::.|
  Rat   271 CTLCLEERRHSTATPCGHLFCWECITEWCNTKTE---CPLCREKFPPQKLVYL 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sordd1NP_573076.1 RING-HC_RNF185 123..179 CDD:438402 18/53 (34%)
Pex10NP_001102875.1 Pex2_Pex12 16..216 CDD:398431
RING-HC_PEX10 271..320 CDD:438190 17/51 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.