DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG8974 and Pex10

DIOPT Version :9

Sequence 1:	NP_573076.1	Gene:	CG8974 / 32532	FlyBaseID:	FBgn0030693	Length:	277	Species:	Drosophila melanogaster
Sequence 2:	NP_001102875.1	Gene:	Pex10 / 680424	RGDID:	1591776	Length:	324	Species:	Rattus norvegicus

Alignment Length:	53	Identity:	18/53 - (33%)
Similarity:	30/53 - (56%)	Gaps:	3/53 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly   125 CNICLDTAKDAVVSMCGHLFCWPCLHQWLLTRPNRKLCPVCKAAVDKDKVIPL 177
            |.:||:..:.:..:.|||||||.|:.:|..|:..   ||:|:......|::.|
  Rat   271 CTLCLEERRHSTATPCGHLFCWECITEWCNTKTE---CPLCREKFPPQKLVYL 320

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG8974	NP_573076.1	RING	124..169	CDD:238093	16/43 (37%)
Pex10	NP_001102875.1	Pex2_Pex12	16..216	CDD:282595
Pex10	NP_001102875.1	zf-RING_2	271..309	CDD:290367	15/40 (38%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5574
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1593722at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.910