DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sordd1 and RNF4

DIOPT Version :10

Sequence 1:NP_573076.1 Gene:sordd1 / 32532 FlyBaseID:FBgn0030693 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_002929.1 Gene:RNF4 / 6047 HGNCID:10067 Length:190 Species:Homo sapiens


Alignment Length:83 Identity:25/83 - (30%)
Similarity:35/83 - (42%) Gaps:10/83 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 TDTKANEKDKEKEHTADDSLYECNICLDTAKDAV------VSM-CGHLFCWPCLHQWLLTRPNRK 160
            |.|..|.:|:............|.||:|...:.|      ||. |||:||..||...|   .|..
Human   110 THTPRNARDEGATGLRPSGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSL---KNAN 171

  Fly   161 LCPVCKAAVDKDKVIPLY 178
            .||.|:..::..:..|:|
Human   172 TCPTCRKKINHKRYHPIY 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sordd1NP_573076.1 RING-HC_RNF185 123..179 CDD:438402 21/63 (33%)
RNF4NP_002929.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
Required for ubiquitination activity. /evidence=ECO:0000250|UniProtKB:Q9QZS2 1..16
Mediates interaction with TRPS1. /evidence=ECO:0000250|UniProtKB:Q9QZS2 4..61
SUMO interaction motif 1. /evidence=ECO:0000269|PubMed:18408734 36..39
SUMO interaction motif 2. /evidence=ECO:0000269|PubMed:18408734 46..49
SUMO interaction motif 3. /evidence=ECO:0000269|PubMed:18408734 57..59
SUMO interaction motif 4. /evidence=ECO:0000269|PubMed:18408734 67..70
RING-HC_RNF4 127..183 CDD:438195 19/58 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.