Protein Alignment CG8974 and TRIM39

DIOPT Version :9

• Sequence 1: NP_573076.1
• Gene: CG8974 / 32532
• FlyBaseID: FBgn0030693
• Length: 277
• Species: Drosophila melanogaster
• Sequence 2: NP_067076.2
• Gene: TRIM39 / 56658
• HGNCID: 10065
• Length: 518
• Species: Homo sapiens
• Alignment Length: 42
• Identity: 16/42 - (38%)
• Similarity: 24/42 - (57%)
• Gaps: 0/42 - (0%)

  Fly   125 CNICLDTAKDAVVSMCGHLFCWPCLHQWLLTRPNRKLCPVCK 166
            |::||:..|:.|:..|||.||..|:.:|.........||||:
Human    29 CSVCLEYLKEPVIIECGHNFCKACITRWWEDLERDFPCPVCR 70

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
CG8974	NP_573076.1	RING	124..169	CDD:238093	16/42 (38%)
TRIM39	NP_067076.2	RAD18	20..>179	CDD:333230	16/42 (38%)
		RING-HC_TRIM39_C-IV	26..69	CDD:319515	14/39 (36%)
		RING-HC finger (C3HC4-type)	29..69	CDD:319515	14/39 (36%)
		AtpF	175..352	CDD:333342
		Interaction with CDKN1A. /evidence=ECO:0000269|PubMed:23213251	268..337
		SPRY_PRY_TRIM39	335..513	CDD:293979
		Interaction with CDKN1A. /evidence=ECO:0000269|PubMed:23213251	389..518

Information from Original Tools

Tool	Simple Score	Weighted Score	Original Tool Information
			BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R146
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.940