DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8974 and Rnf5

DIOPT Version :9

Sequence 1:NP_573076.1 Gene:CG8974 / 32532 FlyBaseID:FBgn0030693 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_062276.1 Gene:Rnf5 / 54197 MGIID:1860076 Length:180 Species:Mus musculus


Alignment Length:179 Identity:89/179 - (49%)
Similarity:114/179 - (63%) Gaps:16/179 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 ANEKD-----KEKEHTADDSLYECNICLDTAKDAVVSMCGHLFCWPCLHQWLLTRPNRKLCPVCK 166
            |.|:|     ..:|.....:.:||||||:||::||||:||||:|||||||||.|||:|:.|||||
Mouse     4 AEEEDGGPEGPNRERGGASATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPDRQECPVCK 68

  Fly   167 AAVDKDKVIPLYGRNSTHQEDPRNKVPPRPAGQRTEPDPVPGFPGFGFGDGFHMSFGIGAFPFGF 231
            |.:.::||:|||||.|...:|||.|.||||.|||..|:...||..||...|||.|||:|||||||
Mouse    69 AGISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDAGGFHFSFGVGAFPFGF 133

  Fly   232 ITSTLNFGEP--RPPAANRG----TRQYEDEQTLSKLFSYLAVVWILWL 274
            .|:..|..||  |....:.|    ...::|     .||.:||:.:..||
Mouse   134 FTTVFNAHEPFRRGAGVDLGQGHPASSWQD-----SLFLFLAIFFFFWL 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8974NP_573076.1 RING 124..169 CDD:238093 35/44 (80%)
Rnf5NP_062276.1 PLN03208 25..>117 CDD:178747 59/91 (65%)
RING-HC_RNF5 25..70 CDD:319657 34/44 (77%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..110 17/30 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842611
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2074
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102074
Panther 1 1.100 - - O PTHR12313
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R146
SonicParanoid 1 1.000 - - X682
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.680

Return to query results.
Submit another query.