powered by:
Protein Alignment CG8974 and PEX10
DIOPT Version :9
Sequence 1: | NP_573076.1 |
Gene: | CG8974 / 32532 |
FlyBaseID: | FBgn0030693 |
Length: | 277 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_722540.1 |
Gene: | PEX10 / 5192 |
HGNCID: | 8851 |
Length: | 346 |
Species: | Homo sapiens |
Alignment Length: | 53 |
Identity: | 18/53 - (33%) |
Similarity: | 28/53 - (52%) |
Gaps: | 3/53 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 125 CNICLDTAKDAVVSMCGHLFCWPCLHQWLLTRPNRKLCPVCKAAVDKDKVIPL 177
|.:||:..:....:.|||||||.|:..|..::.. ||:|:......|:|.|
Human 293 CTLCLEERRHPTATPCGHLFCWECITAWCSSKAE---CPLCREKFPPQKLIYL 342
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG8974 | NP_573076.1 |
RING |
124..169 |
CDD:238093 |
15/43 (35%) |
PEX10 | NP_722540.1 |
Pex2_Pex12 |
18..263 |
CDD:282595 |
|
RING |
293..334 |
CDD:238093 |
15/43 (35%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5574 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1593722at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R146 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.850 |
|
Return to query results.
Submit another query.