DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8974 and pex10

DIOPT Version :9

Sequence 1:NP_573076.1 Gene:CG8974 / 32532 FlyBaseID:FBgn0030693 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001005994.1 Gene:pex10 / 449821 ZFINID:ZDB-GENE-041010-71 Length:318 Species:Danio rerio


Alignment Length:53 Identity:17/53 - (32%)
Similarity:30/53 - (56%) Gaps:3/53 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 CNICLDTAKDAVVSMCGHLFCWPCLHQWLLTRPNRKLCPVCKAAVDKDKVIPL 177
            |.:||:..::...:.|||||||.|:.:|..|:..   ||:|:......:::.|
Zfish   265 CILCLEERRNTTSTPCGHLFCWECITEWCNTKNE---CPLCREKFQPHRLVYL 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8974NP_573076.1 RING 124..169 CDD:238093 16/43 (37%)
pex10NP_001005994.1 Pex2_Pex12 18..237 CDD:282595
zf-RING_2 265..303 CDD:290367 15/40 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593722at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R146
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.