powered by:
Protein Alignment CG8974 and pex10
DIOPT Version :9
Sequence 1: | NP_573076.1 |
Gene: | CG8974 / 32532 |
FlyBaseID: | FBgn0030693 |
Length: | 277 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001005994.1 |
Gene: | pex10 / 449821 |
ZFINID: | ZDB-GENE-041010-71 |
Length: | 318 |
Species: | Danio rerio |
Alignment Length: | 53 |
Identity: | 17/53 - (32%) |
Similarity: | 30/53 - (56%) |
Gaps: | 3/53 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 125 CNICLDTAKDAVVSMCGHLFCWPCLHQWLLTRPNRKLCPVCKAAVDKDKVIPL 177
|.:||:..::...:.|||||||.|:.:|..|:.. ||:|:......:::.|
Zfish 265 CILCLEERRNTTSTPCGHLFCWECITEWCNTKNE---CPLCREKFQPHRLVYL 314
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5574 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1593722at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R146 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.850 |
|
Return to query results.
Submit another query.