DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sordd1 and pex10

DIOPT Version :10

Sequence 1:NP_573076.1 Gene:sordd1 / 32532 FlyBaseID:FBgn0030693 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001005994.1 Gene:pex10 / 449821 ZFINID:ZDB-GENE-041010-71 Length:318 Species:Danio rerio


Alignment Length:53 Identity:17/53 - (32%)
Similarity:30/53 - (56%) Gaps:3/53 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 CNICLDTAKDAVVSMCGHLFCWPCLHQWLLTRPNRKLCPVCKAAVDKDKVIPL 177
            |.:||:..::...:.|||||||.|:.:|..|:..   ||:|:......:::.|
Zfish   265 CILCLEERRNTTSTPCGHLFCWECITEWCNTKNE---CPLCREKFQPHRLVYL 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sordd1NP_573076.1 RING-HC_RNF185 123..179 CDD:438402 17/53 (32%)
pex10NP_001005994.1 Pex2_Pex12 18..237 CDD:398431
RING-HC_PEX10 263..314 CDD:438190 16/51 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.