DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8974 and CG8141

DIOPT Version :9

Sequence 1:NP_573076.1 Gene:CG8974 / 32532 FlyBaseID:FBgn0030693 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_731776.1 Gene:CG8141 / 41622 FlyBaseID:FBgn0038125 Length:239 Species:Drosophila melanogaster


Alignment Length:203 Identity:54/203 - (26%)
Similarity:81/203 - (39%) Gaps:54/203 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 EPLAEESSTSQLRPLGTSIPTNSTASELKKSNTSYSFTGDYLSGGNKADLKGGYPFGGTDTDTKA 107
            |.:|.|:.......:...:|.|.||     .|.|:...|:.:|.|...||          ::...
  Fly     2 EAVARENDPPNHCYINEEVPANETA-----ENPSHGLQGEVISKGYIPDL----------SNANV 51

  Fly   108 NEKDKEKEHTADDSL----------------YECNICLDTAKDAVVSMCGHLFCWPCLHQW-LLT 155
            |::.:::....||.|                |.||.|....:..|:::|||||||.||  | .|:
  Fly    52 NQQQQQENDGEDDLLPGTRLRYRRRNLHLDPYVCNECNQYVRGGVITICGHLFCWTCL--WPKLS 114

  Fly   156 RPNRKLCPVC-KAAVDKDKVIPLYGRN-STHQEDPRNKVP------PRPAGQRTEP--------- 203
            ...:..||.| :..:..:.::|.:|.. :..|||  |.||      |||.|.....         
  Fly   115 GTAQPRCPCCQRHLLMYEDIMPFHGEGPNARQED--NNVPAQPGSVPRPTGLYLSDTDFPCWFAV 177

  Fly   204 -DPVPGFP 210
             |||.|.|
  Fly   178 NDPVDGCP 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8974NP_573076.1 RING 124..169 CDD:238093 18/46 (39%)
CG8141NP_731776.1 zf-C3HC4_2 85..124 CDD:290634 17/40 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5574
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2074
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12313
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.