DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8974 and Rnf5

DIOPT Version :9

Sequence 1:NP_573076.1 Gene:CG8974 / 32532 FlyBaseID:FBgn0030693 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001102495.1 Gene:Rnf5 / 407784 RGDID:1588458 Length:180 Species:Rattus norvegicus


Alignment Length:179 Identity:89/179 - (49%)
Similarity:114/179 - (63%) Gaps:16/179 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 ANEKD-----KEKEHTADDSLYECNICLDTAKDAVVSMCGHLFCWPCLHQWLLTRPNRKLCPVCK 166
            |.|:|     ..:|.....:.:||||||:||::||||:||||:|||||||||.|||:|:.|||||
  Rat     4 AEEEDGGPEGPNRERGGASATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPDRQECPVCK 68

  Fly   167 AAVDKDKVIPLYGRNSTHQEDPRNKVPPRPAGQRTEPDPVPGFPGFGFGDGFHMSFGIGAFPFGF 231
            |.:.::||:|||||.|...:|||.|.||||.|||..|:...||..||...|||.|||:|||||||
  Rat    69 AGISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDAGGFHFSFGVGAFPFGF 133

  Fly   232 ITSTLNFGEP--RPPAANRG----TRQYEDEQTLSKLFSYLAVVWILWL 274
            .|:..|..||  |....:.|    ...::|     .||.:||:.:..||
  Rat   134 FTTVFNAHEPFRRGAGVDLGQGHPASSWQD-----SLFLFLAIFFFFWL 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8974NP_573076.1 RING 124..169 CDD:238093 35/44 (80%)
Rnf5NP_001102495.1 PLN03208 25..>117 CDD:178747 59/91 (65%)
RING-HC_RNF5 25..70 CDD:319657 34/44 (77%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..110 17/30 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346069
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102074
Panther 1 1.100 - - O PTHR12313
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X682
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.700

Return to query results.
Submit another query.