DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8974 and dgrn

DIOPT Version :9

Sequence 1:NP_573076.1 Gene:CG8974 / 32532 FlyBaseID:FBgn0030693 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_649596.1 Gene:dgrn / 40725 FlyBaseID:FBgn0037384 Length:319 Species:Drosophila melanogaster


Alignment Length:81 Identity:22/81 - (27%)
Similarity:42/81 - (51%) Gaps:7/81 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 DTDTKANEK--DKEKEHTADDSLYECNICLDTA--KDAVVSMCGHLFCWPCLHQWLLTRPNRKLC 162
            |.|..:..|  :::.:.:..:.||:|.||:|:.  ::.|.:.|||:||..|:...:  |...| |
  Fly   241 DLDVASPPKRVNRDIDESQKEELYKCPICMDSVSKREPVSTKCGHVFCRECIETAI--RATHK-C 302

  Fly   163 PVCKAAVDKDKVIPLY 178
            |:|...:...:...:|
  Fly   303 PICNKKLTARQFFRIY 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8974NP_573076.1 RING 124..169 CDD:238093 16/46 (35%)
dgrnNP_649596.1 RING 266..305 CDD:214546 15/41 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R146
SonicParanoid 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.